|
PcyM_0012800 | PcyM_0012800-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1149 | PcyM_0012800 | lysophospholipase, putative | lysophospholipase, putative | | | Not Assigned | PcyM_00_15:34,576..35,724(-) | PcyM_00_15:34576..35724(-) | PcyM_00_15 | Plasmodium cynomolgi strain M | 454 | OG6_100231 | 7 | 382 | 1149 | 44380 | 9.86 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0012800ORlysophospholipase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0012800 OR lysophospholipase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0106400 | PcyM_0106400-t36_1 | 8 | 8 | 1 | | | reverse | protein coding | No | 624 | PcyM_0106400 | cysteine-rich secretory protein, putative | cysteine-rich secretory protein, putative | | | 1 | PcyM_01:320,480..322,425(-) | PcyM_01:320480..322425(-) | PcyM_01 | Plasmodium cynomolgi strain M | 37 | OG6_101367 | 0 | 207 | 624 | 23449 | 5.93 | 0 | HMM: MVDRRLHCLFALLCFLTLSRISSCKAA, NN: MVDRRLHCLFALLCFLTLSRISSCKAA | NN Sum: 4, NN D: .76, HMM Prob: 1 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0106400ORcysteine-rich secretory protein, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0106400 OR cysteine-rich secretory protein, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0111000 | PcyM_0111000-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1908 | PcyM_0111000 | lysophospholipase, putative | lysophospholipase, putative | | | 1 | PcyM_01:482,449..484,356(-) | PcyM_01:482449..484356(-) | PcyM_01 | Plasmodium cynomolgi strain M | 454 | OG6_100231 | 7 | 635 | 1908 | 70118 | 9.64 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0111000ORlysophospholipase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0111000 OR lysophospholipase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0111100 | PcyM_0111100-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1263 | PcyM_0111100 | lysophospholipase, putative | lysophospholipase, putative | | | 1 | PcyM_01:486,153..487,415(-) | PcyM_01:486153..487415(-) | PcyM_01 | Plasmodium cynomolgi strain M | 454 | OG6_100231 | 7 | 420 | 1263 | 46706 | 9.83 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0111100ORlysophospholipase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0111100 OR lysophospholipase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0111300 | PcyM_0111300-t36_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 7452 | PcyM_0111300 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | | | 1 | PcyM_01:490,997..499,227(-) | PcyM_01:490997..499227(-) | PcyM_01 | Plasmodium cynomolgi strain M | 43 | OG6_113142 | 0 | 2483 | 7452 | 285008 | 9.97 | 4 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0111300ORconserved Plasmodium protein, unknown functionANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0111300 OR conserved Plasmodium protein, unknown function AND Plasmodium cynomolgi strain M |
|
PcyM_0113200 | PcyM_0113200-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1704 | PcyM_0113200 | plasmepsin X, putative | plasmepsin X, putative | | | 1 | PcyM_01:572,511..574,214(+) | PcyM_01:572511..574214(+) | PcyM_01 | Plasmodium cynomolgi strain M | 91 | OG6_119797 | 1 | 567 | 1704 | 63540 | 5.51 | 0 | HMM: MKHAKGLRMLFCGALFLLHFCREATCH, NN: MKHAKGLRMLFCGALFLLHFCREATCH | NN Sum: 4, NN D: .77, HMM Prob: 1 | | | | | | | | | | | | | | 3.4.23.1 (Pepsin A) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0113200ORplasmepsin X, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0113200 OR plasmepsin X, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0113500 | PcyM_0113500-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3771 | PcyM_0113500 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | | | 1 | PcyM_01:581,698..585,468(-) | PcyM_01:581698..585468(-) | PcyM_01 | Plasmodium cynomolgi strain M | 44 | OG6_128391 | 0 | 1256 | 3771 | 143490 | 10.03 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0113500ORconserved Plasmodium protein, unknown functionANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0113500 OR conserved Plasmodium protein, unknown function AND Plasmodium cynomolgi strain M |
|
PcyM_0113700 | PcyM_0113700-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1464 | PcyM_0113700 | 26S proteasome regulatory subunit RPN10, putative | 26S proteasome regulatory subunit RPN10, putative | | | 1 | PcyM_01:589,847..591,310(+) | PcyM_01:589847..591310(+) | PcyM_01 | Plasmodium cynomolgi strain M | 44 | OG6_102002 | 0 | 487 | 1464 | 53803 | 4.58 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0113700OR26S proteasome regulatory subunit RPN10, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0113700 OR 26S proteasome regulatory subunit RPN10, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0113800 | PcyM_0113800-t36_1 | 5 | 5 | 1 | | | forward | protein coding | No | 3015 | PcyM_0113800 | serine protease DegP, putative | serine protease DegP, putative | | | 1 | PcyM_01:591,921..595,837(+) | PcyM_01:591921..595837(+) | PcyM_01 | Plasmodium cynomolgi strain M | 26 | OG6_105727 | 0 | 1004 | 3015 | 111254 | 9.59 | 0 | HMM: MKLSLLSYSCCVSVVAVMIIRGGGT, NN: MKLSLLSYSCCVSVVAV | NN Sum: 2, NN D: .58, HMM Prob: .9 | | | | | | | | | | | | | | 3.4.21.108 (HtrA2 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0113800ORserine protease DegP, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0113800 OR serine protease DegP, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0114000 | PcyM_0114000-t36_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 783 | PcyM_0114000 | proteasome subunit alpha type-6, putative | proteasome subunit alpha type-6, putative | | | 1 | PcyM_01:603,071..604,375(-) | PcyM_01:603071..604375(-) | PcyM_01 | Plasmodium cynomolgi strain M | 44 | OG6_102240 | 0 | 260 | 783 | 29381 | 5.18 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0114000ORproteasome subunit alpha type-6, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0114000 OR proteasome subunit alpha type-6, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0117400 | PcyM_0117400-t36_1 | 7 | 7 | 1 | | | forward | protein coding | No | 732 | PcyM_0117400 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | | | 1 | PcyM_01:720,129..722,032(+) | PcyM_01:720129..722032(+) | PcyM_01 | Plasmodium cynomolgi strain M | 135 | OG6_100915 | 2 | 243 | 732 | 27918 | 8.30 | 0 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0117400ORalpha/beta hydrolase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0117400 OR alpha/beta hydrolase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0118300 | PcyM_0118300-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2151 | PcyM_0118300 | methionine aminopeptidase 1c, putative | methionine aminopeptidase 1c, putative | | | 1 | PcyM_01:758,156..760,306(-) | PcyM_01:758156..760306(-) | PcyM_01 | Plasmodium cynomolgi strain M | 44 | OG6_171502 | 0 | 716 | 2151 | 83139 | 9.34 | 0 | HMM: MKAHTLVLLTWAFLCLSRRGD, NN: MKAHTLVLLTWAFLCLSRRGDSI | NN Sum: 4, NN D: .7, HMM Prob: 1 | | | | | | | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0118300ORmethionine aminopeptidase 1c, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0118300 OR methionine aminopeptidase 1c, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0118600 | PcyM_0118600-t36_1 | 2 | 2 | 1 | | | forward | protein coding | No | 771 | PcyM_0118600 | proteasome subunit beta type-4, putative | proteasome subunit beta type-4, putative | | | 1 | PcyM_01:771,322..772,348(+) | PcyM_01:771322..772348(+) | PcyM_01 | Plasmodium cynomolgi strain M | 44 | OG6_101718 | 0 | 256 | 771 | 29651 | 7.60 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0118600ORproteasome subunit beta type-4, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0118600 OR proteasome subunit beta type-4, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0121000 | PcyM_0121000-t36_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 5079 | PcyM_0121000 | sentrin-specific protease 2, putative | sentrin-specific protease 2, putative | | | 1 | PcyM_01:884,981..890,527(-) | PcyM_01:884981..890527(-) | PcyM_01 | Plasmodium cynomolgi strain M | 34 | OG6_113308 | 0 | 1692 | 5079 | 189986 | 6.83 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.68 (Ulp1 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0121000ORsentrin-specific protease 2, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0121000 OR sentrin-specific protease 2, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0209100 | PcyM_0209100-t36_1 | 4 | 4 | 1 | | | forward | protein coding | No | 657 | PcyM_0209100 | proteasome subunit beta type-3, putative | proteasome subunit beta type-3, putative | | | 2 | PcyM_02:373,421..374,693(+) | PcyM_02:373421..374693(+) | PcyM_02 | Plasmodium cynomolgi strain M | 45 | OG6_101970 | 0 | 218 | 657 | 24444 | 4.61 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0209100ORproteasome subunit beta type-3, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0209100 OR proteasome subunit beta type-3, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0213600 | PcyM_0213600-t36_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 11904 | PcyM_0213600 | ubiquitin carboxyl-terminal hydrolase 1, putative | ubiquitin carboxyl-terminal hydrolase 1, putative | | | 2 | PcyM_02:509,638..522,264(-) | PcyM_02:509638..522264(-) | PcyM_02 | Plasmodium cynomolgi strain M | 38 | OG6_129339 | 0 | 3967 | 11904 | 440458 | 8.81 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0213600ORubiquitin carboxyl-terminal hydrolase 1, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0213600 OR ubiquitin carboxyl-terminal hydrolase 1, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0214500 | PcyM_0214500-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 5115 | PcyM_0214500 | zinc-carboxypeptidase, putative | zinc-carboxypeptidase, putative | | | 2 | PcyM_02:562,135..567,249(+) | PcyM_02:562135..567249(+) | PcyM_02 | Plasmodium cynomolgi strain M | 36 | OG6_101273 | 0 | 1704 | 5115 | 189679 | 9.61 | 0 | | | | | GO:0004181;GO:0008270 | metallocarboxypeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.17.10 (Carboxypeptidase E) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0214500ORzinc-carboxypeptidase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0214500 OR zinc-carboxypeptidase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0215600 | PcyM_0215600-t36_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 9063 | PcyM_0215600 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | | 2 | PcyM_02:613,510..623,259(-) | PcyM_02:613510..623259(-) | PcyM_02 | Plasmodium cynomolgi strain M | 46 | OG6_101317 | 0 | 3020 | 9063 | 344629 | 7.63 | 0 | | | | | GO:0005515;GO:0036459 | protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0215600ORubiquitin carboxyl-terminal hydrolase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0215600 OR ubiquitin carboxyl-terminal hydrolase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0216600 | PcyM_0216600-t36_1 | 3 | 3 | 1 | | | forward | protein coding | No | 771 | PcyM_0216600 | proteasome subunit alpha type-5, putative | proteasome subunit alpha type-5, putative | | | 2 | PcyM_02:651,261..652,516(+) | PcyM_02:651261..652516(+) | PcyM_02 | Plasmodium cynomolgi strain M | 44 | OG6_101621 | 0 | 256 | 771 | 28368 | 4.71 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0216600ORproteasome subunit alpha type-5, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0216600 OR proteasome subunit alpha type-5, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0217900 | PcyM_0217900-t36_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 1872 | PcyM_0217900 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | | | 2 | PcyM_02:715,979..718,950(-) | PcyM_02:715979..718950(-) | PcyM_02 | Plasmodium cynomolgi strain M | 44 | OG6_110414 | 0 | 623 | 1872 | 70237 | 9.61 | 0 | | | | | | | | | | | | | | | | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0217900ORalpha/beta hydrolase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0217900 OR alpha/beta hydrolase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0305200 | PcyM_0305200-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1152 | PcyM_0305200 | ubiquitin specific protease, putative | ubiquitin specific protease, putative | | | 3 | PcyM_03:275,774..276,925(+) | PcyM_03:275774..276925(+) | PcyM_03 | Plasmodium cynomolgi strain M | 44 | OG6_208753 | 0 | 383 | 1152 | 45116 | 8.70 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0305200ORubiquitin specific protease, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0305200 OR ubiquitin specific protease, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0305600 | PcyM_0305600-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2607 | PcyM_0305600 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | | | 3 | PcyM_03:300,698..303,304(-) | PcyM_03:300698..303304(-) | PcyM_03 | Plasmodium cynomolgi strain M | 135 | OG6_100915 | 2 | 868 | 2607 | 97296 | 9.53 | 0 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0305600ORalpha/beta hydrolase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0305600 OR alpha/beta hydrolase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0306800 | PcyM_0306800-t36_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 2403 | PcyM_0306800 | dipeptidyl aminopeptidase 3, putative | dipeptidyl aminopeptidase 3, putative | | | 3 | PcyM_03:369,442..372,009(-) | PcyM_03:369442..372009(-) | PcyM_03 | Plasmodium cynomolgi strain M | 38 | OG6_533572 | 0 | 800 | 2403 | 91808 | 7.65 | 0 | NN: MILICLLFLSFVSYAKCD, HMM: MILICLLFLSFVSYAKCD | NN Sum: 4, NN D: .85, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.14.4 (Dipeptidyl-peptidase III) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0306800ORdipeptidyl aminopeptidase 3, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0306800 OR dipeptidyl aminopeptidase 3, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0311400 | PcyM_0311400-t36_1 | 5 | 5 | 1 | | | forward | protein coding | No | 2181 | PcyM_0311400 | tRNA N6-adenosine threonylcarbamoyltransferase, putative | tRNA N6-adenosine threonylcarbamoyltransferase, putative | | | 3 | PcyM_03:554,475..557,473(+) | PcyM_03:554475..557473(+) | PcyM_03 | Plasmodium cynomolgi strain M | 88 | OG6_100288 | 1 | 726 | 2181 | 82580 | 9.57 | 0 | NN: MKNAIKNLAICLAFVLSLLRHVHYAY, HMM: MKNAIKNLAICLAFVLSLLRHVHYAY | NN Sum: 4, NN D: .74, HMM Prob: .85 | | | | | | | | | | | | | | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0311400ORtRNA N6-adenosine threonylcarbamoyltransferase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0311400 OR tRNA N6-adenosine threonylcarbamoyltransferase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0318400 | PcyM_0318400-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1416 | PcyM_0318400 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | | | 3 | PcyM_03:830,983..832,398(-) | PcyM_03:830983..832398(-) | PcyM_03 | Plasmodium cynomolgi strain M | 44 | OG6_533066 | 0 | 471 | 1416 | 53265 | 8.88 | 5 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0318400ORconserved Plasmodium protein, unknown functionANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0318400 OR conserved Plasmodium protein, unknown function AND Plasmodium cynomolgi strain M |
|
PcyM_0322600 | PcyM_0322600-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3162 | PcyM_0322600 | ubiquitin C-terminal hydrolase, putative | ubiquitin C-terminal hydrolase, putative | | | 3 | PcyM_03:988,396..991,557(-) | PcyM_03:988396..991557(-) | PcyM_03 | Plasmodium cynomolgi strain M | 43 | OG6_532410 | 0 | 1053 | 3162 | 118197 | 6.66 | 0 | | | | | GO:0008270 | zinc ion binding | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0322600ORubiquitin C-terminal hydrolase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0322600 OR ubiquitin C-terminal hydrolase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0407600 | PcyM_0407600-t36_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 4035 | PcyM_0407600 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | | | 4 | PcyM_04:310,003..314,329(-) | PcyM_04:310003..314329(-) | PcyM_04 | Plasmodium cynomolgi strain M | 20 | OG6_532626 | 0 | 1344 | 4035 | 154655 | 8.58 | 9 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0407600ORconserved Plasmodium protein, unknown functionANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0407600 OR conserved Plasmodium protein, unknown function AND Plasmodium cynomolgi strain M |
|
PcyM_0416000 | PcyM_0416000-t36_1 | 4 | 4 | 1 | | | forward | protein coding | No | 3069 | PcyM_0416000 | serine-repeat antigen 2 (SERA) | serine-repeat antigen 2 (SERA) | | | 4 | PcyM_04:602,767..606,368(+) | PcyM_04:602767..606368(+) | PcyM_04 | Plasmodium cynomolgi strain M | 369 | OG6_126098 | 11 | 1022 | 3069 | 114197 | 6.76 | 0 | NN: MNHRVCFTWAICALLGTDVGAK, HMM: MNHRVCFTWAICALLGTDVGAK | NN Sum: 4, NN D: .69, HMM Prob: .99 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0416000ORserine-repeat antigen 2 (SERA)ANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0416000 OR serine-repeat antigen 2 (SERA) AND Plasmodium cynomolgi strain M |
|
PcyM_0416200 | PcyM_0416200-t36_1 | 4 | 4 | 1 | | | forward | protein coding | No | 3945 | PcyM_0416200 | serine-repeat antigen 4 (SERA) | serine-repeat antigen 4 (SERA) | | | 4 | PcyM_04:607,557..611,961(+) | PcyM_04:607557..611961(+) | PcyM_04 | Plasmodium cynomolgi strain M | 369 | OG6_126098 | 11 | 1314 | 3945 | 144654 | 4.22 | 1 | NN: MKLTLPFLFILSVTLLDNVIKCD, HMM: MKLTLPFLFILSVTLLD | NN Sum: 3, NN D: .6, HMM Prob: .99 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0416200ORserine-repeat antigen 4 (SERA)ANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0416200 OR serine-repeat antigen 4 (SERA) AND Plasmodium cynomolgi strain M |
|
PcyM_0416300 | PcyM_0416300-t36_1 | 4 | 4 | 1 | | | forward | protein coding | No | 3132 | PcyM_0416300 | serine-repeat antigen 3 (SERA) | serine-repeat antigen 3 (SERA) | | | 4 | PcyM_04:614,090..617,700(+) | PcyM_04:614090..617700(+) | PcyM_04 | Plasmodium cynomolgi strain M | 369 | OG6_126098 | 11 | 1043 | 3132 | 112653 | 5.24 | 0 | HMM: MKSRICALLLIGLALANGGARCA, NN: MKSRICALLLIGLALANGGARCA | NN Sum: 4, NN D: .81, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0416300ORserine-repeat antigen 3 (SERA)ANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0416300 OR serine-repeat antigen 3 (SERA) AND Plasmodium cynomolgi strain M |
|
PcyM_0416400 | PcyM_0416400-t36_1 | 3 | 3 | 1 | | | forward | protein coding | No | 3264 | PcyM_0416400 | serine-repeat antigen 1 (SERA), putative | serine-repeat antigen 1 (SERA), putative | | | 4 | PcyM_04:618,824..622,375(+) | PcyM_04:618824..622375(+) | PcyM_04 | Plasmodium cynomolgi strain M | 369 | OG6_126098 | 11 | 1087 | 3264 | 119071 | 4.55 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0416400ORserine-repeat antigen 1 (SERA), putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0416400 OR serine-repeat antigen 1 (SERA), putative AND Plasmodium cynomolgi strain M |
|
PcyM_0416600 | PcyM_0416600-t36_1 | 4 | 4 | 1 | | | forward | protein coding | No | 3198 | PcyM_0416600 | serine-repeat antigen 5 (SERA) | serine-repeat antigen 5 (SERA) | | | 4 | PcyM_04:623,447..627,109(+) | PcyM_04:623447..627109(+) | PcyM_04 | Plasmodium cynomolgi strain M | 369 | OG6_126098 | 11 | 1065 | 3198 | 115223 | 5.23 | 0 | NN: MKSRWCALLILLKCTPGEISE, HMM: MKSRWCALLILLKCTPGE | NN Sum: 4, NN D: .6, HMM Prob: .99 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0416600ORserine-repeat antigen 5 (SERA)ANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0416600 OR serine-repeat antigen 5 (SERA) AND Plasmodium cynomolgi strain M |
|
PcyM_0416700 | PcyM_0416700-t36_1 | 4 | 4 | 1 | | | forward | protein coding | No | 3300 | PcyM_0416700 | cysteine protease, putative | cysteine protease, putative | | | 4 | PcyM_04:629,585..633,495(+) | PcyM_04:629585..633495(+) | PcyM_04 | Plasmodium cynomolgi strain M | 369 | OG6_126098 | 11 | 1099 | 3300 | 119017 | 4.72 | 0 | HMM: MRSCMSVLLLTYAVLNGGILL, NN: MRSCMSVLLLTYAVLNGG | NN Sum: 3, NN D: .6, HMM Prob: .95 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0416700ORcysteine protease, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0416700 OR cysteine protease, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0416800 | PcyM_0416800-t36_1 | 2 | 2 | 1 | | | forward | protein coding | No | 1059 | PcyM_0416800 | cysteine protease, putative | cysteine protease, putative | | | 4 | PcyM_04:637,484..638,651(+) | PcyM_04:637484..638651(+) | PcyM_04 | Plasmodium cynomolgi strain M | 369 | OG6_126098 | 11 | 352 | 1059 | 39871 | 6.72 | 0 | HMM: MLFLLFTKMFNTGALLR, NN: MLFLLFTKMFNTGALLRRNTEGF | NN Sum: 3, NN D: .41, HMM Prob: .04 | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0416800ORcysteine protease, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0416800 OR cysteine protease, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0417100 | PcyM_0417100-t36_1 | 4 | 4 | 1 | | | forward | protein coding | No | 3129 | PcyM_0417100 | serine-repeat antigen 5 (SERA), putative | serine-repeat antigen 5 (SERA), putative | | | 4 | PcyM_04:640,993..644,850(+) | PcyM_04:640993..644850(+) | PcyM_04 | Plasmodium cynomolgi strain M | 369 | OG6_126098 | 11 | 1042 | 3129 | 112918 | 4.83 | 0 | HMM: MKSSFLLLLALGAAYGS, NN: MKSSFLLLLALGAAYGS | NN Sum: 4, NN D: .82, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0417100ORserine-repeat antigen 5 (SERA), putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0417100 OR serine-repeat antigen 5 (SERA), putative AND Plasmodium cynomolgi strain M |
|
PcyM_0417200 | PcyM_0417200-t36_1 | 4 | 4 | 1 | | | forward | protein coding | No | 3243 | PcyM_0417200 | serine-repeat antigen (SERA) | serine-repeat antigen (SERA) | | | 4 | PcyM_04:645,922..649,861(+) | PcyM_04:645922..649861(+) | PcyM_04 | Plasmodium cynomolgi strain M | 369 | OG6_126098 | 11 | 1080 | 3243 | 114877 | 4.54 | 0 | HMM: MKARLSLILILCVVCRDCAVRCT, NN: MKARLSLILILCVVCRDCAV | NN Sum: 4, NN D: .75, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0417200ORserine-repeat antigen (SERA)ANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0417200 OR serine-repeat antigen (SERA) AND Plasmodium cynomolgi strain M |
|
PcyM_0417300 | PcyM_0417300-t36_1 | 4 | 4 | 1 | | | forward | protein coding | No | 3060 | PcyM_0417300 | serine-repeat antigen (SERA) | serine-repeat antigen (SERA) | | | 4 | PcyM_04:651,497..655,258(+) | PcyM_04:651497..655258(+) | PcyM_04 | Plasmodium cynomolgi strain M | 369 | OG6_126098 | 11 | 1019 | 3060 | 113630 | 6.92 | 0 | NN: MIKRPVALILIIAILTSTNLTICE, HMM: MIKRPVALILIIAILTSTNLT | NN Sum: 4, NN D: .71, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0417300ORserine-repeat antigen (SERA)ANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0417300 OR serine-repeat antigen (SERA) AND Plasmodium cynomolgi strain M |
|
PcyM_0417400 | PcyM_0417400-t36_1 | 4 | 4 | 1 | | | forward | protein coding | No | 3243 | PcyM_0417400 | serine-repeat antigen (SERA) | serine-repeat antigen (SERA) | | | 4 | PcyM_04:656,391..660,219(+) | PcyM_04:656391..660219(+) | PcyM_04 | Plasmodium cynomolgi strain M | 369 | OG6_126098 | 11 | 1080 | 3243 | 118156 | 5.17 | 0 | HMM: MVSRLCFLLTICVALGTHVTHCAGD, NN: MVSRLCFLLTICVALGTHVTHCAGD | NN Sum: 4, NN D: .72, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0417400ORserine-repeat antigen (SERA)ANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0417400 OR serine-repeat antigen (SERA) AND Plasmodium cynomolgi strain M |
|
PcyM_0417500 | PcyM_0417500-t36_1 | 6 | 6 | 1 | | | forward | protein coding | No | 2157 | PcyM_0417500 | serine-repeat antigen (SERA) | serine-repeat antigen (SERA) | | | 4 | PcyM_04:662,398..665,778(+) | PcyM_04:662398..665778(+) | PcyM_04 | Plasmodium cynomolgi strain M | 369 | OG6_126098 | 11 | 718 | 2157 | 83419 | 7.02 | 0 | HMM: MKINQIAQYVLLVLVAHLVKRVKSN, NN: MKINQIAQYVLLVLVAHLVKRVKSN | NN Sum: 4, NN D: .74, HMM Prob: .6 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0417500ORserine-repeat antigen (SERA)ANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0417500 OR serine-repeat antigen (SERA) AND Plasmodium cynomolgi strain M |
|
PcyM_0502000 | PcyM_0502000-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1128 | PcyM_0502000 | lysophospholipase, putative | lysophospholipase, putative | | | 5 | PcyM_05:105,561..106,688(-) | PcyM_05:105561..106688(-) | PcyM_05 | Plasmodium cynomolgi strain M | 454 | OG6_100231 | 7 | 375 | 1128 | 42700 | 7.73 | 1 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0502000ORlysophospholipase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0502000 OR lysophospholipase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0505200 | PcyM_0505200-t36_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 807 | PcyM_0505200 | rhomboid protease ROM3, putative | rhomboid protease ROM3, putative | | | 5 | PcyM_05:247,012..248,262(-) | PcyM_05:247012..248262(-) | PcyM_05 | Plasmodium cynomolgi strain M | 93 | OG6_100562 | 1 | 268 | 807 | 30189 | 7.93 | 7 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0505200ORrhomboid protease ROM3, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0505200 OR rhomboid protease ROM3, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0507100 | PcyM_0507100-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1464 | PcyM_0507100 | SPRY domain, putative | SPRY domain, putative | | | 5 | PcyM_05:318,271..319,734(-) | PcyM_05:318271..319734(-) | PcyM_05 | Plasmodium cynomolgi strain M | 44 | OG6_102272 | 0 | 487 | 1464 | 54449 | 7.04 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0507100ORSPRY domain, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0507100 OR SPRY domain, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0507200 | PcyM_0507200-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 2271 | PcyM_0507200 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | | | 5 | PcyM_05:322,492..324,762(+) | PcyM_05:322492..324762(+) | PcyM_05 | Plasmodium cynomolgi strain M | 67 | OG6_129556 | 0 | 756 | 2271 | 85450 | 10.01 | 0 | | | | | | | | | | | | | | | | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0507200ORalpha/beta hydrolase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0507200 OR alpha/beta hydrolase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0510100 | PcyM_0510100-t36_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 1575 | PcyM_0510100 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | | | 5 | PcyM_05:442,829..445,234(-) | PcyM_05:442829..445234(-) | PcyM_05 | Plasmodium cynomolgi strain M | 44 | OG6_105308 | 0 | 524 | 1575 | 60383 | 7.59 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0510100ORalpha/beta hydrolase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0510100 OR alpha/beta hydrolase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0516300 | PcyM_0516300-t36_1 | 11 | 11 | 1 | | | forward | protein coding | No | 903 | PcyM_0516300 | BEM46-like protein, putative | BEM46-like protein, putative | | | 5 | PcyM_05:678,776..682,017(+) | PcyM_05:678776..682017(+) | PcyM_05 | Plasmodium cynomolgi strain M | 45 | OG6_101827 | 0 | 300 | 903 | 34675 | 9.60 | 1 | NN: MKLLKFLWIPVVTVLLLVLVLNGY, HMM: MKLLKFLWIPVVTVLLLVLVLNGY | NN Sum: 4, NN D: .86, HMM Prob: .72 | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0516300ORBEM46-like protein, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0516300 OR BEM46-like protein, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0519600 | PcyM_0519600-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 3228 | PcyM_0519600 | chaperone protein ClpB1, putative | chaperone protein ClpB1, putative | | | 5 | PcyM_05:763,624..766,851(+) | PcyM_05:763624..766851(+) | PcyM_05 | Plasmodium cynomolgi strain M | 95 | OG6_100223 | 1 | 1075 | 3228 | 120505 | 9.21 | 0 | NN: MCRVRKRASSLLFFLISSLFIWEEQSGK, HMM: MCRVRKRASSLLFFLISSLFIWEEQSGK | NN Sum: 3, NN D: .58, HMM Prob: .57 | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0519600ORchaperone protein ClpB1, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0519600 OR chaperone protein ClpB1, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0521400 | PcyM_0521400-t36_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1179 | PcyM_0521400 | 26S proteasome AAA-ATPase subunit RPT3, putative | 26S proteasome AAA-ATPase subunit RPT3, putative | | | 5 | PcyM_05:809,045..810,483(-) | PcyM_05:809045..810483(-) | PcyM_05 | Plasmodium cynomolgi strain M | 42 | OG6_101965 | 0 | 392 | 1179 | 44773 | 8.93 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0521400OR26S proteasome AAA-ATPase subunit RPT3, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0521400 OR 26S proteasome AAA-ATPase subunit RPT3, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0521800 | PcyM_0521800-t36_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 2712 | PcyM_0521800 | ubiquitin carboxyl-terminal hydrolase 13, putative | ubiquitin carboxyl-terminal hydrolase 13, putative | | | 5 | PcyM_05:816,856..820,186(-) | PcyM_05:816856..820186(-) | PcyM_05 | Plasmodium cynomolgi strain M | 42 | OG6_101380 | 0 | 903 | 2712 | 102667 | 5.14 | 0 | | | | | GO:0004843;GO:0036459;GO:0008270 | thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0521800ORubiquitin carboxyl-terminal hydrolase 13, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0521800 OR ubiquitin carboxyl-terminal hydrolase 13, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0529400 | PcyM_0529400-t36_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1074 | PcyM_0529400 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | | | 5 | PcyM_05:1,106,828..1,108,207(-) | PcyM_05:1106828..1108207(-) | PcyM_05 | Plasmodium cynomolgi strain M | 43 | OG6_174320 | 0 | 357 | 1074 | 41632 | 9.66 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0529400ORconserved Plasmodium protein, unknown functionANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0529400 OR conserved Plasmodium protein, unknown function AND Plasmodium cynomolgi strain M |
|
PcyM_0534500 | PcyM_0534500-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1263 | PcyM_0534500 | lysophospholipase, putative | lysophospholipase, putative | | | 5 | PcyM_05:1,338,023..1,339,285(+) | PcyM_05:1338023..1339285(+) | PcyM_05 | Plasmodium cynomolgi strain M | 454 | OG6_100231 | 7 | 420 | 1263 | 47201 | 5.33 | 1 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0534500ORlysophospholipase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0534500 OR lysophospholipase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0602500 | PcyM_0602500-t36_1 | 2 | 2 | 1 | | | forward | protein coding | No | 1728 | PcyM_0602500 | enoyl-CoA hydratase-related protein, putative | enoyl-CoA hydratase-related protein, putative | | | 6 | PcyM_06:103,053..104,936(+) | PcyM_06:103053..104936(+) | PcyM_06 | Plasmodium cynomolgi strain M | 43 | OG6_134153 | 0 | 575 | 1728 | 66781 | 8.59 | 0 | NN: MVAPHCCPVLLPHIVAPHCRSTL, HMM: MVAPHCCPVLLPHIVAPHCRSTLSL | NN Sum: 0, NN D: .27, HMM Prob: .53 | | | GO:0003860 | 3-hydroxyisobutyryl-CoA hydrolase activity | | | | | | | | | | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0602500ORenoyl-CoA hydratase-related protein, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0602500 OR enoyl-CoA hydratase-related protein, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0603700 | PcyM_0603700-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2733 | PcyM_0603700 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | | | 6 | PcyM_06:142,403..145,135(-) | PcyM_06:142403..145135(-) | PcyM_06 | Plasmodium cynomolgi strain M | 44 | OG6_124535 | 0 | 910 | 2733 | 100306 | 4.87 | 2 | HMM: MDLNHVKYRGWFVLPLLLPFLLPFLLWGLILLD, NN: MDLNHVKYRGWFVLPLLLPFLLPFLLWGL | NN Sum: 4, NN D: .66, HMM Prob: .6 | | | | | | | | | | | | | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0603700ORconserved Plasmodium protein, unknown functionANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0603700 OR conserved Plasmodium protein, unknown function AND Plasmodium cynomolgi strain M |
|
PcyM_0605900 | PcyM_0605900-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 375 | PcyM_0605900 | autophagy-related protein 8, putative | autophagy-related protein 8, putative | | | 6 | PcyM_06:226,486..226,860(-) | PcyM_06:226486..226860(-) | PcyM_06 | Plasmodium cynomolgi strain M | 45 | OG6_100707 | 0 | 124 | 375 | 14620 | 8.04 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0605900ORautophagy-related protein 8, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0605900 OR autophagy-related protein 8, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0619300 | PcyM_0619300-t36_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1887 | PcyM_0619300 | tRNA N6-adenosine threonylcarbamoyltransferase, putative | tRNA N6-adenosine threonylcarbamoyltransferase, putative | | | 6 | PcyM_06:718,889..720,827(-) | PcyM_06:718889..720827(-) | PcyM_06 | Plasmodium cynomolgi strain M | 88 | OG6_100288 | 1 | 628 | 1887 | 69239 | 6.55 | 0 | | | | | | | | | | | | | | | | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0619300ORtRNA N6-adenosine threonylcarbamoyltransferase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0619300 OR tRNA N6-adenosine threonylcarbamoyltransferase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0620400 | PcyM_0620400-t36_1 | 8 | 8 | 1 | | | forward | protein coding | No | 2883 | PcyM_0620400 | OTU-like cysteine protease, putative | OTU-like cysteine protease, putative | | | 6 | PcyM_06:743,241..747,535(+) | PcyM_06:743241..747535(+) | PcyM_06 | Plasmodium cynomolgi strain M | 45 | OG6_104209 | 0 | 960 | 2883 | 109102 | 7.92 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0620400OROTU-like cysteine protease, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0620400 OR OTU-like cysteine protease, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0621600 | PcyM_0621600-t36_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 789 | PcyM_0621600 | DER1-like protein, putative | DER1-like protein, putative | | | 6 | PcyM_06:789,086..790,450(-) | PcyM_06:789086..790450(-) | PcyM_06 | Plasmodium cynomolgi strain M | 44 | OG6_113960 | 0 | 262 | 789 | 30808 | 9.83 | 5 | HMM: MDISGPEVWYGNLPNVTKYLITLIFLVTLLITCNLL, NN: MDISGPEVWYGNLPNVTKYLITLIFLVTLLITCNLL | NN Sum: 3, NN D: .49, HMM Prob: .03 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0621600ORDER1-like protein, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0621600 OR DER1-like protein, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0623300 | PcyM_0623300-t36_1 | 8 | 8 | 1 | | | forward | protein coding | No | 1437 | PcyM_0623300 | aspartyl protease, putative | aspartyl protease, putative | | | 6 | PcyM_06:843,094..845,841(+) | PcyM_06:843094..845841(+) | PcyM_06 | Plasmodium cynomolgi strain M | 46 | OG6_139465 | 0 | 478 | 1437 | 54492 | 8.70 | 1 | HMM: MTPNFVARIGLLCLLNIWLSTFSL, NN: MTPNFVARIGLLCLLNIWLSTFSL | NN Sum: 3, NN D: .68, HMM Prob: .96 | | | | | | | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0623300ORaspartyl protease, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0623300 OR aspartyl protease, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0702100 | PcyM_0702100-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 558 | PcyM_0702100 | signal peptidase complex subunit 3, putative | signal peptidase complex subunit 3, putative | | | 7 | PcyM_07:115,269..115,826(-) | PcyM_07:115269..115826(-) | PcyM_07 | Plasmodium cynomolgi strain M | 43 | OG6_102447 | 0 | 185 | 558 | 21784 | 9.35 | 1 | HMM: MDNVLNRLNVLSYSMALCFFALCLFNYGTSF, NN: MDNVLNRLNVLSYSMALCFFALCLFNYGTSF | NN Sum: 4, NN D: .67, HMM Prob: .5 | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0702100ORsignal peptidase complex subunit 3, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0702100 OR signal peptidase complex subunit 3, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0702300 | PcyM_0702300-t36_1 | 2 | 2 | 1 | | | forward | protein coding | No | 4677 | PcyM_0702300 | ubiquitin specific protease, putative | ubiquitin specific protease, putative | | | 7 | PcyM_07:121,723..126,580(+) | PcyM_07:121723..126580(+) | PcyM_07 | Plasmodium cynomolgi strain M | 47 | OG6_101457 | 1 | 1558 | 4677 | 174677 | 8.40 | 0 | | | | | GO:0004843;GO:0036459 | thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0702300ORubiquitin specific protease, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0702300 OR ubiquitin specific protease, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0705300 | PcyM_0705300-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2538 | PcyM_0705300 | ATP-dependent protease ATPase subunit ClpY, putative | ATP-dependent protease ATPase subunit ClpY, putative | | | 7 | PcyM_07:278,215..280,752(-) | PcyM_07:278215..280752(-) | PcyM_07 | Plasmodium cynomolgi strain M | 44 | OG6_106348 | 0 | 845 | 2538 | 95901 | 8.22 | 0 | | | GO:0009376;GO:0005737 | HslUV protease complex;cytoplasm | GO:0005524;GO:0016887;GO:0070011 | ATP binding;ATPase activity;peptidase activity, acting on L-amino acid peptides | | | | | | | | | | 2.7.1.71 (Shikimate kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0705300ORATP-dependent protease ATPase subunit ClpY, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0705300 OR ATP-dependent protease ATPase subunit ClpY, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0711100 | PcyM_0711100-t36_1 | 2 | 2 | 1 | | | forward | protein coding | No | 1005 | PcyM_0711100 | 26S proteasome regulatory subunit RPN8, putative | 26S proteasome regulatory subunit RPN8, putative | | | 7 | PcyM_07:511,862..513,020(+) | PcyM_07:511862..513020(+) | PcyM_07 | Plasmodium cynomolgi strain M | 47 | OG6_102054 | 0 | 334 | 1005 | 38417 | 6.62 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0711100OR26S proteasome regulatory subunit RPN8, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0711100 OR 26S proteasome regulatory subunit RPN8, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0711700 | PcyM_0711700-t36_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 1311 | PcyM_0711700 | protease, putative | protease, putative | | | 7 | PcyM_07:527,110..528,775(-) | PcyM_07:527110..528775(-) | PcyM_07 | Plasmodium cynomolgi strain M | 43 | OG6_112025 | 0 | 436 | 1311 | 51707 | 9.70 | 8 | NN: MMLPFFCIGLILQLYVGCF, HMM: MMLPFFCIGLILQLYVGCF | NN Sum: 3, NN D: .65, HMM Prob: .87 | GO:0016020 | membrane | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0711700ORprotease, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0711700 OR protease, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0716600 | PcyM_0716600-t36_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 963 | PcyM_0716600 | eukaryotic translation initiation factor 3 subunit F, putative | eukaryotic translation initiation factor 3 subunit F, putative | | | 7 | PcyM_07:711,725..712,863(-) | PcyM_07:711725..712863(-) | PcyM_07 | Plasmodium cynomolgi strain M | 44 | OG6_103242 | 0 | 320 | 963 | 36610 | 6.87 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0716600OReukaryotic translation initiation factor 3 subunit F, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0716600 OR eukaryotic translation initiation factor 3 subunit F, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0717600 | PcyM_0717600-t36_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 918 | PcyM_0717600 | PPPDE peptidase, putative | PPPDE peptidase, putative | | | 7 | PcyM_07:753,365..754,410(-) | PcyM_07:753365..754410(-) | PcyM_07 | Plasmodium cynomolgi strain M | 90 | OG6_101256 | 1 | 305 | 918 | 34128 | 8.85 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0717600ORPPPDE peptidase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0717600 OR PPPDE peptidase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0721900 | PcyM_0721900-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 699 | PcyM_0721900 | OTU-like cysteine protease, putative | OTU-like cysteine protease, putative | | | 7 | PcyM_07:919,254..919,952(-) | PcyM_07:919254..919952(-) | PcyM_07 | Plasmodium cynomolgi strain M | 44 | OG6_124705 | 0 | 232 | 699 | 27388 | 9.41 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0721900OROTU-like cysteine protease, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0721900 OR OTU-like cysteine protease, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0733000 | PcyM_0733000-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 849 | PcyM_0733000 | proteasome subunit beta type-6, putative | proteasome subunit beta type-6, putative | | | 7 | PcyM_07:1,289,207..1,290,055(-) | PcyM_07:1289207..1290055(-) | PcyM_07 | Plasmodium cynomolgi strain M | 44 | OG6_101390 | 0 | 282 | 849 | 32147 | 6.71 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0733000ORproteasome subunit beta type-6, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0733000 OR proteasome subunit beta type-6, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0733600 | PcyM_0733600-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1608 | PcyM_0733600 | M18 aspartyl aminopeptidase, putative | M18 aspartyl aminopeptidase, putative | | | 7 | PcyM_07:1,305,931..1,307,538(-) | PcyM_07:1305931..1307538(-) | PcyM_07 | Plasmodium cynomolgi strain M | 44 | OG6_102047 | 0 | 535 | 1608 | 60069 | 6.96 | 0 | | | | | GO:0004177;GO:0008270 | aminopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.11.21 (Aspartyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0733600ORM18 aspartyl aminopeptidase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0733600 OR M18 aspartyl aminopeptidase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0735400 | PcyM_0735400-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1440 | PcyM_0735400 | mitochondrial-processing peptidase subunit beta, putative | mitochondrial-processing peptidase subunit beta, putative | | | 7 | PcyM_07:1,348,911..1,350,350(-) | PcyM_07:1348911..1350350(-) | PcyM_07 | Plasmodium cynomolgi strain M | 44 | OG6_100777 | 0 | 479 | 1440 | 54431 | 6.33 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0735400ORmitochondrial-processing peptidase subunit beta, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0735400 OR mitochondrial-processing peptidase subunit beta, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0805100 | PcyM_0805100-t36_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 2196 | PcyM_0805100 | DnaJ protein, putative | DnaJ protein, putative | | | 8 | PcyM_08:233,156..235,468(-) | PcyM_08:233156..235468(-) | PcyM_08 | Plasmodium cynomolgi strain M | 45 | OG6_100561 | 0 | 731 | 2196 | 84597 | 9.54 | 0 | HMM: MNSGRKFIINKCIFLIFSKISPMLCGAE, NN: MNSGRKFIINKCIFLIFSKISPMLCGAE | NN Sum: 3, NN D: .41, HMM Prob: .02 | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.15 (Thimet oligopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0805100ORDnaJ protein, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0805100 OR DnaJ protein, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0806400 | PcyM_0806400-t36_1 | 8 | 8 | 1 | | | forward | protein coding | No | 645 | PcyM_0806400 | PPPDE peptidase, putative | PPPDE peptidase, putative | | | 8 | PcyM_08:275,105..277,234(+) | PcyM_08:275105..277234(+) | PcyM_08 | Plasmodium cynomolgi strain M | 90 | OG6_101256 | 1 | 214 | 645 | 24127 | 6.77 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0806400ORPPPDE peptidase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0806400 OR PPPDE peptidase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0808000 | PcyM_0808000-t36_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1344 | PcyM_0808000 | 26S protease regulatory subunit 4, putative | 26S protease regulatory subunit 4, putative | | | 8 | PcyM_08:349,586..351,224(-) | PcyM_08:349586..351224(-) | PcyM_08 | Plasmodium cynomolgi strain M | 45 | OG6_101477 | 0 | 447 | 1344 | 49821 | 8.04 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0808000OR26S protease regulatory subunit 4, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0808000 OR 26S protease regulatory subunit 4, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0809500 | PcyM_0809500-t36_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 984 | PcyM_0809500 | metallopeptidase, putative | metallopeptidase, putative | | | 8 | PcyM_08:408,578..410,458(-) | PcyM_08:408578..410458(-) | PcyM_08 | Plasmodium cynomolgi strain M | 45 | OG6_108834 | 0 | 327 | 984 | 37279 | 9.83 | 0 | | | | | | | | | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0809500ORmetallopeptidase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0809500 OR metallopeptidase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0811700 | PcyM_0811700-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 813 | PcyM_0811700 | proteasome subunit beta type-5, putative | proteasome subunit beta type-5, putative | | | 8 | PcyM_08:481,940..482,752(-) | PcyM_08:481940..482752(-) | PcyM_08 | Plasmodium cynomolgi strain M | 44 | OG6_100897 | 0 | 270 | 813 | 30422 | 5.63 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0811700ORproteasome subunit beta type-5, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0811700 OR proteasome subunit beta type-5, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0816000 | PcyM_0816000-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1365 | PcyM_0816000 | methionine aminopeptidase 1b, putative | methionine aminopeptidase 1b, putative | | | 8 | PcyM_08:677,533..678,897(+) | PcyM_08:677533..678897(+) | PcyM_08 | Plasmodium cynomolgi strain M | 43 | OG6_100342 | 0 | 454 | 1365 | 52495 | 7.28 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0816000ORmethionine aminopeptidase 1b, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0816000 OR methionine aminopeptidase 1b, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0820000 | PcyM_0820000-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 2658 | PcyM_0820000 | peptidase, putative | peptidase, putative | | | 8 | PcyM_08:819,805..822,462(+) | PcyM_08:819805..822462(+) | PcyM_08 | Plasmodium cynomolgi strain M | 45 | OG6_102438 | 0 | 885 | 2658 | 102321 | 7.84 | 3 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.19.1 (Acylaminoacyl-peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0820000ORpeptidase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0820000 OR peptidase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0821100 | PcyM_0821100-t36_1 | 8 | 8 | 1 | | | reverse | protein coding | No | 564 | PcyM_0821100 | signal peptidase complex subunit 2, putative | signal peptidase complex subunit 2, putative | | | 8 | PcyM_08:856,816..858,678(-) | PcyM_08:856816..858678(-) | PcyM_08 | Plasmodium cynomolgi strain M | 44 | OG6_137524 | 0 | 187 | 564 | 22159 | 6.52 | 2 | | | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0821100ORsignal peptidase complex subunit 2, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0821100 OR signal peptidase complex subunit 2, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0824100 | PcyM_0824100-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 753 | PcyM_0824100 | proteasome regulatory protein, putative | proteasome regulatory protein, putative | | | 8 | PcyM_08:994,811..995,563(+) | PcyM_08:994811..995563(+) | PcyM_08 | Plasmodium cynomolgi strain M | 44 | OG6_102356 | 0 | 250 | 753 | 29086 | 6.28 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0824100ORproteasome regulatory protein, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0824100 OR proteasome regulatory protein, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0824900 | PcyM_0824900-t36_1 | 2 | 2 | 1 | | | forward | protein coding | No | 762 | PcyM_0824900 | proteasome subunit alpha type-3, putative | proteasome subunit alpha type-3, putative | | | 8 | PcyM_08:1,051,857..1,052,780(+) | PcyM_08:1051857..1052780(+) | PcyM_08 | Plasmodium cynomolgi strain M | 44 | OG6_102011 | 0 | 253 | 762 | 29002 | 6.39 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0824900ORproteasome subunit alpha type-3, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0824900 OR proteasome subunit alpha type-3, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0827900 | PcyM_0827900-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1221 | PcyM_0827900 | DER1-like protein, putative | DER1-like protein, putative | | | 8 | PcyM_08:1,169,839..1,171,059(+) | PcyM_08:1169839..1171059(+) | PcyM_08 | Plasmodium cynomolgi strain M | 87 | OG6_130104 | 1 | 406 | 1221 | 47946 | 10.03 | 3 | NN: MFLLRRLLALLCVIIVSVRHQHAR, HMM: MFLLRRLLALLCVIIVSVRHQHAR | NN Sum: 4, NN D: .8, HMM Prob: .98 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0827900ORDER1-like protein, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0827900 OR DER1-like protein, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0828000 | PcyM_0828000-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 3747 | PcyM_0828000 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | | | 8 | PcyM_08:1,171,294..1,175,040(+) | PcyM_08:1171294..1175040(+) | PcyM_08 | Plasmodium cynomolgi strain M | 42 | OG6_533302 | 0 | 1248 | 3747 | 145193 | 10.04 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0828000ORconserved Plasmodium protein, unknown functionANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0828000 OR conserved Plasmodium protein, unknown function AND Plasmodium cynomolgi strain M |
|
PcyM_0831100 | PcyM_0831100-t36_1 | 15 | 15 | 1 | | | reverse | protein coding | No | 1317 | PcyM_0831100 | aspartyl proteinase, putative | aspartyl proteinase, putative | | | 8 | PcyM_08:1,249,316..1,252,921(-) | PcyM_08:1249316..1252921(-) | PcyM_08 | Plasmodium cynomolgi strain M | 158 | OG6_100536 | 1 | 438 | 1317 | 49447 | 8.05 | 1 | NN: MGRAFLFAPLFALFVALLPPPILCV, HMM: MGRAFLFAPLFALFVALLPPPILCV | NN Sum: 4, NN D: .83, HMM Prob: 1 | | | | | | | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0831100ORaspartyl proteinase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0831100 OR aspartyl proteinase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0836800 | PcyM_0836800-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1200 | PcyM_0836800 | ATP-dependent Clp protease proteolytic subunit, putative | ATP-dependent Clp protease proteolytic subunit, putative | | | 8 | PcyM_08:1,445,208..1,446,407(+) | PcyM_08:1445208..1446407(+) | PcyM_08 | Plasmodium cynomolgi strain M | 44 | OG6_100939 | 0 | 399 | 1200 | 43786 | 9.75 | 0 | NN: MVCLFSLLLFTLLRNNKTHAK, HMM: MVCLFSLLLFTLLRNNKTHAK | NN Sum: 4, NN D: .64, HMM Prob: .99 | | | | | | | | | | | | | | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0836800ORATP-dependent Clp protease proteolytic subunit, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0836800 OR ATP-dependent Clp protease proteolytic subunit, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0914000 | PcyM_0914000-t36_1 | 3 | 3 | 1 | | | forward | protein coding | No | 777 | PcyM_0914000 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | | | 9 | PcyM_09:650,106..651,642(+) | PcyM_09:650106..651642(+) | PcyM_09 | Plasmodium cynomolgi strain M | 43 | OG6_104335 | 0 | 258 | 777 | 29748 | 7.18 | 0 | | | | | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0914000ORconserved Plasmodium protein, unknown functionANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0914000 OR conserved Plasmodium protein, unknown function AND Plasmodium cynomolgi strain M |
|
PcyM_0916500 | PcyM_0916500-t36_1 | 4 | 4 | 1 | | | forward | protein coding | No | 831 | PcyM_0916500 | rhomboid protease ROM1, putative | rhomboid protease ROM1, putative | | | 9 | PcyM_09:739,371..740,851(+) | PcyM_09:739371..740851(+) | PcyM_09 | Plasmodium cynomolgi strain M | 93 | OG6_100562 | 1 | 276 | 831 | 31394 | 9.42 | 7 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0916500ORrhomboid protease ROM1, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0916500 OR rhomboid protease ROM1, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0917600 | PcyM_0917600-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1473 | PcyM_0917600 | cysteine proteinase, putative | cysteine proteinase, putative | | | 9 | PcyM_09:785,967..787,439(-) | PcyM_09:785967..787439(-) | PcyM_09 | Plasmodium cynomolgi strain M | 157 | OG6_100116 | 3 | 490 | 1473 | 55818 | 6.31 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0917600ORcysteine proteinase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0917600 OR cysteine proteinase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0917700 | PcyM_0917700-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1488 | PcyM_0917700 | cysteine proteinase, putative | cysteine proteinase, putative | | | 9 | PcyM_09:790,432..791,919(-) | PcyM_09:790432..791919(-) | PcyM_09 | Plasmodium cynomolgi strain M | 157 | OG6_100116 | 3 | 495 | 1488 | 57143 | 8.07 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0917700ORcysteine proteinase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0917700 OR cysteine proteinase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0917900 | PcyM_0917900-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1464 | PcyM_0917900 | cysteine proteinase, putative | cysteine proteinase, putative | | | 9 | PcyM_09:794,202..795,665(-) | PcyM_09:794202..795665(-) | PcyM_09 | Plasmodium cynomolgi strain M | 157 | OG6_100116 | 3 | 487 | 1464 | 55310 | 6.14 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0917900ORcysteine proteinase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0917900 OR cysteine proteinase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0918500 | PcyM_0918500-t36_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 2280 | PcyM_0918500 | rhoptry neck protein 4, putative | rhoptry neck protein 4, putative | | | 9 | PcyM_09:807,985..810,769(-) | PcyM_09:807985..810769(-) | PcyM_09 | Plasmodium cynomolgi strain M | 40 | OG6_211592 | 0 | 759 | 2280 | 83763 | 5.00 | 0 | HMM: MSRKRVFLLCIFLAISAVVDEAESF, NN: MSRKRVFLLCIFLAISAVVDEAESF | NN Sum: 4, NN D: .79, HMM Prob: .98 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0918500ORrhoptry neck protein 4, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0918500 OR rhoptry neck protein 4, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0918600 | PcyM_0918600-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 5001 | PcyM_0918600 | serine esterase, putative | serine esterase, putative | | | 9 | PcyM_09:812,503..817,503(-) | PcyM_09:812503..817503(-) | PcyM_09 | Plasmodium cynomolgi strain M | 44 | OG6_154686 | 0 | 1666 | 5001 | 186476 | 10.01 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0918600ORserine esterase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0918600 OR serine esterase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0918700 | PcyM_0918700-t36_1 | 7 | 7 | 1 | | | reverse | protein coding | No | 660 | PcyM_0918700 | pyridoxine biosynthesis protein PDX2, putative | pyridoxine biosynthesis protein PDX2, putative | | | 9 | PcyM_09:820,334..822,090(-) | PcyM_09:820334..822090(-) | PcyM_09 | Plasmodium cynomolgi strain M | 49 | OG6_103407 | 0 | 219 | 660 | 24701 | 8.47 | 0 | | | | | GO:0004359 | glutaminase activity | GO:0042823;GO:0042819 | pyridoxal phosphate biosynthetic process;vitamin B6 biosynthetic process | | | | | | | | 3.5.1.2 (Glutaminase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0918700ORpyridoxine biosynthesis protein PDX2, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0918700 OR pyridoxine biosynthesis protein PDX2, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0919200 | PcyM_0919200-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2043 | PcyM_0919200 | dipeptidyl aminopeptidase 1, putative | dipeptidyl aminopeptidase 1, putative | | | 9 | PcyM_09:836,464..838,506(-) | PcyM_09:836464..838506(-) | PcyM_09 | Plasmodium cynomolgi strain M | 90 | OG6_103622 | 1 | 680 | 2043 | 77695 | 6.21 | 0 | NN: MRRARNILSFGLILLHTLYVNLTSAD, HMM: MRRARNILSFGLILLHTLYVNLTSAD | NN Sum: 4, NN D: .85, HMM Prob: .98 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.14.1 (Dipeptidyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0919200ORdipeptidyl aminopeptidase 1, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0919200 OR dipeptidyl aminopeptidase 1, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0919300 | PcyM_0919300-t36_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 2724 | PcyM_0919300 | heat shock protein 101, putative | heat shock protein 101, putative | | | 9 | PcyM_09:842,167..845,500(-) | PcyM_09:842167..845500(-) | PcyM_09 | Plasmodium cynomolgi strain M | 95 | OG6_100223 | 1 | 907 | 2724 | 102931 | 9.44 | 0 | HMM: MRLRRVFIWCLYLITLFFVCKNELASCSAN, NN: MRLRRVFIWCLYLITLFFVCKNELASCSAN | NN Sum: 4, NN D: .68, HMM Prob: .32 | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0919300ORheat shock protein 101, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0919300 OR heat shock protein 101, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0919700 | PcyM_0919700-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1941 | PcyM_0919700 | ubiquitin C-terminal hydrolase, family 1, putative | ubiquitin C-terminal hydrolase, family 1, putative | | | 9 | PcyM_09:859,370..861,310(+) | PcyM_09:859370..861310(+) | PcyM_09 | Plasmodium cynomolgi strain M | 44 | OG6_102753 | 0 | 646 | 1941 | 73032 | 7.78 | 1 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0919700ORubiquitin C-terminal hydrolase, family 1, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0919700 OR ubiquitin C-terminal hydrolase, family 1, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0920800 | PcyM_0920800-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 4401 | PcyM_0920800 | insulinase, putative | insulinase, putative | | | 9 | PcyM_09:902,755..907,155(+) | PcyM_09:902755..907155(+) | PcyM_09 | Plasmodium cynomolgi strain M | 47 | OG6_105738 | 0 | 1466 | 4401 | 165596 | 4.66 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0920800ORinsulinase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0920800 OR insulinase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0922300 | PcyM_0922300-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2985 | PcyM_0922300 | ATP-dependent zinc metalloprotease FTSH, putative | ATP-dependent zinc metalloprotease FTSH, putative | | | 9 | PcyM_09:949,574..952,558(-) | PcyM_09:949574..952558(-) | PcyM_09 | Plasmodium cynomolgi strain M | 91 | OG6_100384 | 1 | 994 | 2985 | 109612 | 9.38 | 1 | | | GO:0016021;GO:0016020 | integral component of membrane;membrane | GO:0005524;GO:0004222;GO:0008270 | ATP binding;metalloendopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0922300ORATP-dependent zinc metalloprotease FTSH, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0922300 OR ATP-dependent zinc metalloprotease FTSH, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0923400 | PcyM_0923400-t36_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1101 | PcyM_0923400 | alpha/beta hydrolase fold domain containing protein, putative | alpha/beta hydrolase fold domain containing protein, putative | | | 9 | PcyM_09:984,909..986,199(-) | PcyM_09:984909..986199(-) | PcyM_09 | Plasmodium cynomolgi strain M | 135 | OG6_100915 | 2 | 366 | 1101 | 42319 | 9.40 | 1 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0923400ORalpha/beta hydrolase fold domain containing protein, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0923400 OR alpha/beta hydrolase fold domain containing protein, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0924900 | PcyM_0924900-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 5034 | PcyM_0924900 | petidase, M16 family, putative | petidase, M16 family, putative | | | 9 | PcyM_09:1,043,907..1,048,940(-) | PcyM_09:1043907..1048940(-) | PcyM_09 | Plasmodium cynomolgi strain M | 43 | OG6_108964 | 0 | 1677 | 5034 | 192902 | 6.65 | 0 | NN: MAITKCSVINILFLLLLFYQECSSC, HMM: MAITKCSVINILFLLLLFYQECSSCQ | NN Sum: 4, NN D: .86, HMM Prob: .99 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.55 (Pitrilysin) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0924900ORpetidase, M16 family, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0924900 OR petidase, M16 family, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0931000 | PcyM_0931000-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2640 | PcyM_0931000 | steryl ester hydrolase, putative | steryl ester hydrolase, putative | | | 9 | PcyM_09:1,283,665..1,286,304(-) | PcyM_09:1283665..1286304(-) | PcyM_09 | Plasmodium cynomolgi strain M | 35 | OG6_100408 | 0 | 879 | 2640 | 98451 | 4.59 | 0 | | | | | | | GO:0006629 | lipid metabolic process | | | | | | | | 3.1.1.3 (Triacylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0931000ORsteryl ester hydrolase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0931000 OR steryl ester hydrolase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0933300 | PcyM_0933300-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1413 | PcyM_0933300 | GPI-anchor transamidase, putative | GPI-anchor transamidase, putative | | | 9 | PcyM_09:1,378,139..1,379,551(+) | PcyM_09:1378139..1379551(+) | PcyM_09 | Plasmodium cynomolgi strain M | 44 | OG6_101767 | 0 | 470 | 1413 | 55033 | 9.24 | 1 | NN: MELKKAFLCCVLLAVKHAVAPS, HMM: MELKKAFLCCVLLAVKHAVAP | NN Sum: 3, NN D: .62, HMM Prob: 1 | | | GO:0008233 | peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0933300ORGPI-anchor transamidase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0933300 OR GPI-anchor transamidase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0935100 | PcyM_0935100-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1326 | PcyM_0935100 | 26S protease regulatory subunit 6a, putative | 26S protease regulatory subunit 6a, putative | | | 9 | PcyM_09:1,434,705..1,436,030(+) | PcyM_09:1434705..1436030(+) | PcyM_09 | Plasmodium cynomolgi strain M | 44 | OG6_101915 | 0 | 441 | 1326 | 49643 | 4.80 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0935100OR26S protease regulatory subunit 6a, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0935100 OR 26S protease regulatory subunit 6a, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0938200 | PcyM_0938200-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1689 | PcyM_0938200 | apical membrane antigen 1, putative | apical membrane antigen 1, putative | | | 9 | PcyM_09:1,562,874..1,564,562(+) | PcyM_09:1562874..1564562(+) | PcyM_09 | Plasmodium cynomolgi strain M | 44 | OG6_130922 | 0 | 562 | 1689 | 64666 | 6.51 | 1 | | | GO:0016020 | membrane | | | GO:0009405 | pathogenesis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0938200ORapical membrane antigen 1, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0938200 OR apical membrane antigen 1, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0941900 | PcyM_0941900-t36_1 | 3 | 3 | 1 | | | forward | protein coding | No | 4245 | PcyM_0941900 | subtilisin-like protease 2, putative | subtilisin-like protease 2, putative | | | 9 | PcyM_09:1,738,101..1,742,590(+) | PcyM_09:1738101..1742590(+) | PcyM_09 | Plasmodium cynomolgi strain M | 42 | OG6_100121 | 0 | 1414 | 4245 | 159358 | 6.51 | 1 | HMM: MLSLFYVLPLIMMNILFQN, NN: MLSLFYVLPLIMMNILFQN | NN Sum: 2, NN D: .52, HMM Prob: .38 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0941900ORsubtilisin-like protease 2, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0941900 OR subtilisin-like protease 2, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0946400 | PcyM_0946400-t36_1 | 5 | 5 | 1 | | | forward | protein coding | No | 981 | PcyM_0946400 | OTU domain-containing protein, putative | OTU domain-containing protein, putative | | | 9 | PcyM_09:1,987,032..1,988,859(+) | PcyM_09:1987032..1988859(+) | PcyM_09 | Plasmodium cynomolgi strain M | 43 | OG6_102788 | 0 | 326 | 981 | 37902 | 5.64 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0946400OROTU domain-containing protein, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0946400 OR OTU domain-containing protein, putative AND Plasmodium cynomolgi strain M |
|
PcyM_0947800 | PcyM_0947800-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1347 | PcyM_0947800 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | | | 9 | PcyM_09:2,050,227..2,051,573(+) | PcyM_09:2050227..2051573(+) | PcyM_09 | Plasmodium cynomolgi strain M | 44 | OG6_101420 | 0 | 448 | 1347 | 50116 | 9.45 | 0 | HMM: MRSPLARTICALLYAVSLCKCF, NN: MRSPLARTICALLYAVSLCKCF | NN Sum: 4, NN D: .65, HMM Prob: .97 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_0947800ORalpha/beta hydrolase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_0947800 OR alpha/beta hydrolase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1004200 | PcyM_1004200-t36_1 | 3 | 3 | 1 | | | forward | protein coding | No | 972 | PcyM_1004200 | methionine aminopeptidase 1a, putative | methionine aminopeptidase 1a, putative | | | 10 | PcyM_10:156,050..158,003(+) | PcyM_10:156050..158003(+) | PcyM_10 | Plasmodium cynomolgi strain M | 43 | OG6_124490 | 0 | 323 | 972 | 36483 | 7.23 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1004200ORmethionine aminopeptidase 1a, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1004200 OR methionine aminopeptidase 1a, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1004300 | PcyM_1004300-t36_1 | 2 | 2 | 1 | | | forward | protein coding | No | 1779 | PcyM_1004300 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | | 10 | PcyM_10:159,773..162,096(+) | PcyM_10:159773..162096(+) | PcyM_10 | Plasmodium cynomolgi strain M | 44 | OG6_101892 | 0 | 592 | 1779 | 66623 | 5.28 | 0 | | | | | GO:0005515;GO:0036459 | protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1004300ORubiquitin carboxyl-terminal hydrolase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1004300 OR ubiquitin carboxyl-terminal hydrolase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1008700 | PcyM_1008700-t36_1 | 2 | 2 | 1 | | | forward | protein coding | No | 1605 | PcyM_1008700 | mitochondrial processing peptidase alpha subunit, putative | mitochondrial processing peptidase alpha subunit, putative | | | 10 | PcyM_10:340,734..342,661(+) | PcyM_10:340734..342661(+) | PcyM_10 | Plasmodium cynomolgi strain M | 44 | OG6_102381 | 0 | 534 | 1605 | 61127 | 8.82 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1008700ORmitochondrial processing peptidase alpha subunit, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1008700 OR mitochondrial processing peptidase alpha subunit, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1013700 | PcyM_1013700-t36_1 | 4 | 4 | 1 | | | forward | protein coding | No | 726 | PcyM_1013700 | proteasome subunit beta type-1, putative | proteasome subunit beta type-1, putative | | | 10 | PcyM_10:561,072..562,470(+) | PcyM_10:561072..562470(+) | PcyM_10 | Plasmodium cynomolgi strain M | 44 | OG6_101631 | 0 | 241 | 726 | 27222 | 6.79 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1013700ORproteasome subunit beta type-1, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1013700 OR proteasome subunit beta type-1, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1014600 | PcyM_1014600-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2151 | PcyM_1014600 | eukaryotic translation initiation factor 3 subunit B, putative | eukaryotic translation initiation factor 3 subunit B, putative | | | 10 | PcyM_10:585,353..587,503(-) | PcyM_10:585353..587503(-) | PcyM_10 | Plasmodium cynomolgi strain M | 45 | OG6_101924 | 0 | 716 | 2151 | 84060 | 8.29 | 0 | | | GO:0005852 | eukaryotic translation initiation factor 3 complex | GO:0003723;GO:0003676;GO:0003743;GO:0031369 | RNA binding;nucleic acid binding;translation initiation factor activity;translation initiation factor binding | GO:0006413 | translational initiation | | | | | | | | 3.6.3.14 (Transferred entry: 7.1.2.2) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1014600OReukaryotic translation initiation factor 3 subunit B, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1014600 OR eukaryotic translation initiation factor 3 subunit B, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1014900 | PcyM_1014900-t36_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 3219 | PcyM_1014900 | FACT complex subunit SPT16, putative | FACT complex subunit SPT16, putative | | | 10 | PcyM_10:596,599..600,087(-) | PcyM_10:596599..600087(-) | PcyM_10 | Plasmodium cynomolgi strain M | 38 | OG6_102309 | 0 | 1072 | 3219 | 123839 | 5.00 | 0 | | | | | | | | | | | | | | | | 1.1.1.27 (L-lactate dehydrogenase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1014900ORFACT complex subunit SPT16, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1014900 OR FACT complex subunit SPT16, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1015800 | PcyM_1015800-t36_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 4080 | PcyM_1015800 | ubiquitin carboxyl-terminal hydrolase 2, putative | ubiquitin carboxyl-terminal hydrolase 2, putative | | | 10 | PcyM_10:634,688..639,166(-) | PcyM_10:634688..639166(-) | PcyM_10 | Plasmodium cynomolgi strain M | 48 | OG6_101021 | 0 | 1359 | 4080 | 154937 | 6.71 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1015800ORubiquitin carboxyl-terminal hydrolase 2, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1015800 OR ubiquitin carboxyl-terminal hydrolase 2, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1017700 | PcyM_1017700-t36_1 | 3 | 3 | 1 | | | forward | protein coding | No | 1233 | PcyM_1017700 | rhomboid protease ROM9, putative | rhomboid protease ROM9, putative | | | 10 | PcyM_10:703,947..705,422(+) | PcyM_10:703947..705422(+) | PcyM_10 | Plasmodium cynomolgi strain M | 35 | OG6_106921 | 0 | 410 | 1233 | 47624 | 10.11 | 6 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1017700ORrhomboid protease ROM9, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1017700 OR rhomboid protease ROM9, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1026500 | PcyM_1026500-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1935 | PcyM_1026500 | subtilisin-like protease 1, putative | subtilisin-like protease 1, putative | | | 10 | PcyM_10:1,043,738..1,045,672(+) | PcyM_10:1043738..1045672(+) | PcyM_10 | Plasmodium cynomolgi strain M | 49 | OG6_121085 | 0 | 644 | 1935 | 71705 | 5.53 | 0 | NN: MGLTRRIALLLCPWVVQLLIQRTLGS, HMM: MGLTRRIALLLCPWVVQLLIQRTLGS | NN Sum: 4, NN D: .79, HMM Prob: 1 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.62 (Subtilisin) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1026500ORsubtilisin-like protease 1, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1026500 OR subtilisin-like protease 1, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1026700 | PcyM_1026700-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 3606 | PcyM_1026700 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | | | 10 | PcyM_10:1,048,920..1,052,525(+) | PcyM_10:1048920..1052525(+) | PcyM_10 | Plasmodium cynomolgi strain M | 30 | OG6_533144 | 0 | 1201 | 3606 | 132102 | 5.40 | 1 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1026700ORconserved Plasmodium protein, unknown functionANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1026700 OR conserved Plasmodium protein, unknown function AND Plasmodium cynomolgi strain M |
|
PcyM_1026800 | PcyM_1026800-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1995 | PcyM_1026800 | subtilisin-like protease 3, putative | subtilisin-like protease 3, putative | | | 10 | PcyM_10:1,054,242..1,056,236(+) | PcyM_10:1054242..1056236(+) | PcyM_10 | Plasmodium cynomolgi strain M | 42 | OG6_532299 | 0 | 664 | 1995 | 71322 | 8.84 | 0 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.62 (Subtilisin) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1026800ORsubtilisin-like protease 3, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1026800 OR subtilisin-like protease 3, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1027100 | PcyM_1027100-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1866 | PcyM_1027100 | rhomboid protease ROM4, putative | rhomboid protease ROM4, putative | | | 10 | PcyM_10:1,063,204..1,065,069(+) | PcyM_10:1063204..1065069(+) | PcyM_10 | Plasmodium cynomolgi strain M | 44 | OG6_126349 | 0 | 621 | 1866 | 69328 | 9.38 | 7 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1027100ORrhomboid protease ROM4, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1027100 OR rhomboid protease ROM4, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1035400 | PcyM_1035400-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1137 | PcyM_1035400 | lysophospholipase, putative | lysophospholipase, putative | | | 10 | PcyM_10:1,411,093..1,412,229(-) | PcyM_10:1411093..1412229(-) | PcyM_10 | Plasmodium cynomolgi strain M | 454 | OG6_100231 | 7 | 378 | 1137 | 44419 | 9.95 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1035400ORlysophospholipase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1035400 OR lysophospholipase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1103100 | PcyM_1103100-t36_1 | 3 | 3 | 1 | | | forward | protein coding | No | 936 | PcyM_1103100 | 26S proteasome regulatory subunit RPN11, putative | 26S proteasome regulatory subunit RPN11, putative | | | 11 | PcyM_11:125,526..126,752(+) | PcyM_11:125526..126752(+) | PcyM_11 | Plasmodium cynomolgi strain M | 43 | OG6_101835 | 0 | 311 | 936 | 35036 | 7.20 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1103100OR26S proteasome regulatory subunit RPN11, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1103100 OR 26S proteasome regulatory subunit RPN11, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1109000 | PcyM_1109000-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 6408 | PcyM_1109000 | calpain, putative | calpain, putative | | | 11 | PcyM_11:349,139..355,546(-) | PcyM_11:349139..355546(-) | PcyM_11 | Plasmodium cynomolgi strain M | 44 | OG6_103851 | 0 | 2135 | 6408 | 243947 | 9.88 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1109000ORcalpain, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1109000 OR calpain, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1109900 | PcyM_1109900-t36_1 | 12 | 12 | 1 | | | forward | protein coding | No | 1101 | PcyM_1109900 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | | | 11 | PcyM_11:389,034..392,151(+) | PcyM_11:389034..392151(+) | PcyM_11 | Plasmodium cynomolgi strain M | 41 | OG6_129725 | 0 | 366 | 1101 | 43085 | 8.03 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1109900ORconserved Plasmodium protein, unknown functionANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1109900 OR conserved Plasmodium protein, unknown function AND Plasmodium cynomolgi strain M |
|
PcyM_1110700 | PcyM_1110700-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3462 | PcyM_1110700 | falcilysin, putative | falcilysin, putative | | | 11 | PcyM_11:426,068..429,529(-) | PcyM_11:426068..429529(-) | PcyM_11 | Plasmodium cynomolgi strain M | 44 | OG6_101809 | 0 | 1153 | 3462 | 133499 | 6.39 | 0 | NN: MKLMRVLGYLNIITNCVNGL, HMM: MKLMRVLGYLNIITNCVNGL | NN Sum: 4, NN D: .55, HMM Prob: .3 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1110700ORfalcilysin, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1110700 OR falcilysin, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1111700 | PcyM_1111700-t36_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 6144 | PcyM_1111700 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | | | 11 | PcyM_11:467,510..473,654(-) | PcyM_11:467510..473654(-) | PcyM_11 | Plasmodium cynomolgi strain M | 46 | OG6_156430 | 0 | 2047 | 6144 | 235214 | 9.92 | 4 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1111700ORconserved Plasmodium protein, unknown functionANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1111700 OR conserved Plasmodium protein, unknown function AND Plasmodium cynomolgi strain M |
|
PcyM_1113300 | PcyM_1113300-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1008 | PcyM_1113300 | rhomboid protease ROM7, putative | rhomboid protease ROM7, putative | | | 11 | PcyM_11:562,585..563,592(+) | PcyM_11:562585..563592(+) | PcyM_11 | Plasmodium cynomolgi strain M | 44 | OG6_533468 | 0 | 335 | 1008 | 39972 | 10.11 | 5 | HMM: MNLLILLAIATCLTRGNAF, NN: MNLLILLAIATCLTRGNAF | NN Sum: 4, NN D: .81, HMM Prob: 1 | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1113300ORrhomboid protease ROM7, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1113300 OR rhomboid protease ROM7, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1115400 | PcyM_1115400-t36_1 | 7 | 7 | 1 | | | reverse | protein coding | No | 609 | PcyM_1115400 | ubiquitin-conjugating enzyme, putative | ubiquitin-conjugating enzyme, putative | | | 11 | PcyM_11:647,249..649,036(-) | PcyM_11:647249..649036(-) | PcyM_11 | Plasmodium cynomolgi strain M | 44 | OG6_103192 | 0 | 202 | 609 | 22924 | 4.95 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1115400ORubiquitin-conjugating enzyme, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1115400 OR ubiquitin-conjugating enzyme, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1117100 | PcyM_1117100-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 2046 | PcyM_1117100 | metacaspase 1, putative | metacaspase 1, putative | | | 11 | PcyM_11:709,281..711,326(+) | PcyM_11:709281..711326(+) | PcyM_11 | Plasmodium cynomolgi strain M | 83 | OG6_101407 | 1 | 681 | 2046 | 77141 | 8.36 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1117100ORmetacaspase 1, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1117100 OR metacaspase 1, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1118100 | PcyM_1118100-t36_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 726 | PcyM_1118100 | proteasome subunit alpha type-7, putative | proteasome subunit alpha type-7, putative | | | 11 | PcyM_11:736,922..738,228(-) | PcyM_11:736922..738228(-) | PcyM_11 | Plasmodium cynomolgi strain M | 45 | OG6_101207 | 0 | 241 | 726 | 27079 | 7.41 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1118100ORproteasome subunit alpha type-7, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1118100 OR proteasome subunit alpha type-7, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1118200 | PcyM_1118200-t36_1 | 2 | 2 | 1 | | | forward | protein coding | No | 741 | PcyM_1118200 | proteasome subunit alpha type-4, putative | proteasome subunit alpha type-4, putative | | | 11 | PcyM_11:740,182..741,071(+) | PcyM_11:740182..741071(+) | PcyM_11 | Plasmodium cynomolgi strain M | 45 | OG6_101968 | 0 | 246 | 741 | 27823 | 6.55 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1118200ORproteasome subunit alpha type-4, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1118200 OR proteasome subunit alpha type-4, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1120800 | PcyM_1120800-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2736 | PcyM_1120800 | phosphatidylcholine-sterol acyltransferase, putative | phosphatidylcholine-sterol acyltransferase, putative | | | 11 | PcyM_11:855,532..858,267(-) | PcyM_11:855532..858267(-) | PcyM_11 | Plasmodium cynomolgi strain M | 44 | OG6_101376 | 0 | 911 | 2736 | 100412 | 4.73 | 0 | HMM: MSILFLLIALWHLLMPTSSVLGF, NN: MSILFLLIALWHLLMPTSSVLGF | NN Sum: 4, NN D: .82, HMM Prob: 1 | | | GO:0008374 | O-acyltransferase activity | GO:0006629 | lipid metabolic process | | | | | | | | 2.3.1.43 (Phosphatidylcholine--sterol O-acyltransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1120800ORphosphatidylcholine-sterol acyltransferase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1120800 OR phosphatidylcholine-sterol acyltransferase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1121700 | PcyM_1121700-t36_1 | 8 | 8 | 1 | | | reverse | protein coding | No | 1047 | PcyM_1121700 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | | | 11 | PcyM_11:886,451..888,835(-) | PcyM_11:886451..888835(-) | PcyM_11 | Plasmodium cynomolgi strain M | 44 | OG6_168022 | 0 | 348 | 1047 | 39538 | 7.75 | 8 | | | | | GO:0008233 | peptidase activity | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1121700ORconserved Plasmodium protein, unknown functionANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1121700 OR conserved Plasmodium protein, unknown function AND Plasmodium cynomolgi strain M |
|
PcyM_1122700 | PcyM_1122700-t36_1 | 3 | 3 | 1 | | | forward | protein coding | No | 570 | PcyM_1122700 | protein DJ-1, putative | protein DJ-1, putative | | | 11 | PcyM_11:960,833..961,856(+) | PcyM_11:960833..961856(+) | PcyM_11 | Plasmodium cynomolgi strain M | 44 | OG6_101257 | 0 | 189 | 570 | 20219 | 6.50 | 0 | | | | | | | | | | | | | | | | 2.7.1.50 (Hydroxyethylthiazole kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1122700ORprotein DJ-1, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1122700 OR protein DJ-1, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1122900 | PcyM_1122900-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1566 | PcyM_1122900 | E3 ubiquitin-protein ligase RNF5, putative | E3 ubiquitin-protein ligase RNF5, putative | | | 11 | PcyM_11:966,278..967,843(+) | PcyM_11:966278..967843(+) | PcyM_11 | Plasmodium cynomolgi strain M | 44 | OG6_102074 | 0 | 521 | 1566 | 58446 | 4.84 | 1 | | | | | | | | | | | | | | | | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1122900ORE3 ubiquitin-protein ligase RNF5, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1122900 OR E3 ubiquitin-protein ligase RNF5, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1132100 | PcyM_1132100-t36_1 | 8 | 8 | 1 | | | forward | protein coding | No | 825 | PcyM_1132100 | rhomboid protease ROM10, putative | rhomboid protease ROM10, putative | | | 11 | PcyM_11:1,321,459..1,323,810(+) | PcyM_11:1321459..1323810(+) | PcyM_11 | Plasmodium cynomolgi strain M | 44 | OG6_103838 | 0 | 274 | 825 | 31292 | 9.92 | 5 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1132100ORrhomboid protease ROM10, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1132100 OR rhomboid protease ROM10, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1143400 | PcyM_1143400-t36_1 | 2 | 2 | 1 | | | forward | protein coding | No | 708 | PcyM_1143400 | proteasome subunit alpha type-2, putative | proteasome subunit alpha type-2, putative | | | 11 | PcyM_11:1,742,277..1,743,278(+) | PcyM_11:1742277..1743278(+) | PcyM_11 | Plasmodium cynomolgi strain M | 43 | OG6_101969 | 0 | 235 | 708 | 26437 | 4.88 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1143400ORproteasome subunit alpha type-2, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1143400 OR proteasome subunit alpha type-2, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1148200 | PcyM_1148200-t36_1 | 20 | 20 | 1 | | | forward | protein coding | No | 5649 | PcyM_1148200 | centrosomal protein CEP76, putative | centrosomal protein CEP76, putative | | | 11 | PcyM_11:1,950,398..1,960,243(+) | PcyM_11:1950398..1960243(+) | PcyM_11 | Plasmodium cynomolgi strain M | 46 | OG6_126374 | 0 | 1882 | 5649 | 220185 | 7.13 | 1 | | | | | | | | | | | | | | | | 1.3.-.- (Acting on the CH-CH group of donors.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1148200ORcentrosomal protein CEP76, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1148200 OR centrosomal protein CEP76, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1206500 | PcyM_1206500-t36_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 732 | PcyM_1206500 | peptidase, putative | peptidase, putative | | | 12 | PcyM_12:320,825..321,827(-) | PcyM_12:320825..321827(-) | PcyM_12 | Plasmodium cynomolgi strain M | 44 | OG6_110253 | 0 | 243 | 732 | 27870 | 7.80 | 6 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1206500ORpeptidase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1206500 OR peptidase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1211200 | PcyM_1211200-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1749 | PcyM_1211200 | rhomboid protease ROM6, putative | rhomboid protease ROM6, putative | | | 12 | PcyM_12:525,316..527,064(+) | PcyM_12:525316..527064(+) | PcyM_12 | Plasmodium cynomolgi strain M | 44 | OG6_124366 | 0 | 582 | 1749 | 67637 | 10.37 | 5 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1211200ORrhomboid protease ROM6, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1211200 OR rhomboid protease ROM6, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1218700 | PcyM_1218700-t36_1 | 8 | 8 | 1 | | | forward | protein coding | No | 1386 | PcyM_1218700 | SprT-like domain-containing protein, putative | SprT-like domain-containing protein, putative | | | 12 | PcyM_12:819,830..822,604(+) | PcyM_12:819830..822604(+) | PcyM_12 | Plasmodium cynomolgi strain M | 45 | OG6_104384 | 0 | 461 | 1386 | 53418 | 8.41 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1218700ORSprT-like domain-containing protein, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1218700 OR SprT-like domain-containing protein, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1220400 | PcyM_1220400-t36_1 | 2 | 2 | 1 | | | forward | protein coding | No | 3018 | PcyM_1220400 | mitochondrial intermediate peptidase, putative | mitochondrial intermediate peptidase, putative | | | 12 | PcyM_12:880,423..883,586(+) | PcyM_12:880423..883586(+) | PcyM_12 | Plasmodium cynomolgi strain M | 44 | OG6_102110 | 0 | 1005 | 3018 | 116528 | 7.36 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.59 (Mitochondrial intermediate peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1220400ORmitochondrial intermediate peptidase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1220400 OR mitochondrial intermediate peptidase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1226200 | PcyM_1226200-t36_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 555 | PcyM_1226200 | signal peptidase 21 kDa subunit, putative | signal peptidase 21 kDa subunit, putative | | | 12 | PcyM_12:1,055,211..1,056,019(-) | PcyM_12:1055211..1056019(-) | PcyM_12 | Plasmodium cynomolgi strain M | 44 | OG6_100807 | 0 | 184 | 555 | 21067 | 6.39 | 2 | | | GO:0016020 | membrane | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1226200ORsignal peptidase 21 kDa subunit, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1226200 OR signal peptidase 21 kDa subunit, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1229400 | PcyM_1229400-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 2931 | PcyM_1229400 | alpha/beta-hydrolase, putative | alpha/beta-hydrolase, putative | | | 12 | PcyM_12:1,165,550..1,168,480(+) | PcyM_12:1165550..1168480(+) | PcyM_12 | Plasmodium cynomolgi strain M | 120 | OG6_157547 | 0 | 976 | 2931 | 108544 | 6.67 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1229400ORalpha/beta-hydrolase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1229400 OR alpha/beta-hydrolase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1230000 | PcyM_1230000-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 813 | PcyM_1230000 | proteasome subunit beta type-7, putative | proteasome subunit beta type-7, putative | | | 12 | PcyM_12:1,202,267..1,203,079(-) | PcyM_12:1202267..1203079(-) | PcyM_12 | Plasmodium cynomolgi strain M | 43 | OG6_101382 | 0 | 270 | 813 | 29607 | 7.87 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1230000ORproteasome subunit beta type-7, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1230000 OR proteasome subunit beta type-7, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1235800 | PcyM_1235800-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1665 | PcyM_1235800 | plasmepsin V, putative | plasmepsin V, putative | | | 12 | PcyM_12:1,425,103..1,426,767(-) | PcyM_12:1425103..1426767(-) | PcyM_12 | Plasmodium cynomolgi strain M | 44 | OG6_107443 | 0 | 554 | 1665 | 63268 | 7.96 | 1 | NN: MGTARYGNPGCGSLSRIIHLVLYVLTLYALNAECK, HMM: MGTARYGNPGCGSLSRIIHLVLYVLTLYALNAE | NN Sum: 3, NN D: .55, HMM Prob: .25 | | | | | | | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1235800ORplasmepsin V, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1235800 OR plasmepsin V, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1239500 | PcyM_1239500-t36_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 3375 | PcyM_1239500 | M1-family alanyl aminopeptidase, putative | M1-family alanyl aminopeptidase, putative | | | 12 | PcyM_12:1,559,653..1,563,502(-) | PcyM_12:1559653..1563502(-) | PcyM_12 | Plasmodium cynomolgi strain M | 37 | OG6_532703 | 0 | 1124 | 3375 | 133195 | 10.71 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | | 3.4.11.2 (Membrane alanyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1239500ORM1-family alanyl aminopeptidase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1239500 OR M1-family alanyl aminopeptidase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1240000 | PcyM_1240000-t36_1 | 3 | 3 | 1 | | | forward | protein coding | No | 6039 | PcyM_1240000 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | | | 12 | PcyM_12:1,579,547..1,585,919(+) | PcyM_12:1579547..1585919(+) | PcyM_12 | Plasmodium cynomolgi strain M | 32 | OG6_532336 | 0 | 2012 | 6039 | 231409 | 8.64 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1240000ORconserved Plasmodium protein, unknown functionANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1240000 OR conserved Plasmodium protein, unknown function AND Plasmodium cynomolgi strain M |
|
PcyM_1241100 | PcyM_1241100-t36_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 588 | PcyM_1241100 | proteasome subunit beta type-2, putative | proteasome subunit beta type-2, putative | | | 12 | PcyM_12:1,624,882..1,625,755(-) | PcyM_12:1624882..1625755(-) | PcyM_12 | Plasmodium cynomolgi strain M | 44 | OG6_102061 | 0 | 195 | 588 | 22847 | 8.52 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1241100ORproteasome subunit beta type-2, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1241100 OR proteasome subunit beta type-2, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1242600 | PcyM_1242600-t36_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 9375 | PcyM_1242600 | biotin carboxylase subunit of acetyl CoA carboxylase, putative | biotin carboxylase subunit of acetyl CoA carboxylase, putative | | | 12 | PcyM_12:1,661,937..1,671,819(-) | PcyM_12:1661937..1671819(-) | PcyM_12 | Plasmodium cynomolgi strain M | 41 | OG6_101052 | 0 | 3124 | 9375 | 351042 | 7.55 | 0 | NN: MVNGLTGALSLVLLLQNLVEPI, HMM: MVNGLTGALSLVLLLQNLVEPI | NN Sum: 3, NN D: .62, HMM Prob: .93 | | | GO:0005524;GO:0016874;GO:0046872 | ATP binding;ligase activity;metal ion binding | | | | | | | | | | 6.4.1.2 (Acetyl-CoA carboxylase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1242600ORbiotin carboxylase subunit of acetyl CoA carboxylase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1242600 OR biotin carboxylase subunit of acetyl CoA carboxylase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1243700 | PcyM_1243700-t36_1 | 6 | 6 | 1 | | | forward | protein coding | No | 642 | PcyM_1243700 | derlin-1, putative | derlin-1, putative | | | 12 | PcyM_12:1,714,831..1,716,484(+) | PcyM_12:1714831..1716484(+) | PcyM_12 | Plasmodium cynomolgi strain M | 44 | OG6_101672 | 0 | 213 | 642 | 24943 | 7.33 | 5 | NN: MVQLGEILGTIPLITRVYLILSSVLMVLCS, HMM: MVQLGEILGTIPLITRVYLILSSVLMVLCSLD | NN Sum: 2, NN D: .56, HMM Prob: .15 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1243700ORderlin-1, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1243700 OR derlin-1, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1247100 | PcyM_1247100-t36_1 | 13 | 13 | 1 | | | forward | protein coding | No | 1122 | PcyM_1247100 | aspartyl proteinase, putative | aspartyl proteinase, putative | | | 12 | PcyM_12:1,880,551..1,883,317(+) | PcyM_12:1880551..1883317(+) | PcyM_12 | Plasmodium cynomolgi strain M | 44 | OG6_124673 | 0 | 373 | 1122 | 42493 | 9.67 | 0 | NN: MNVLLSFFVFLILNVRPWVKSA, HMM: MNVLLSFFVFLILNVRPWVKSA | NN Sum: 4, NN D: .72, HMM Prob: .98 | | | | | | | | | | | | | | 3.4.17.4 (Gly-Xaa carboxypeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1247100ORaspartyl proteinase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1247100 OR aspartyl proteinase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1247900 | PcyM_1247900-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 2109 | PcyM_1247900 | ATP-dependent zinc metalloprotease FTSH, putative | ATP-dependent zinc metalloprotease FTSH, putative | | | 12 | PcyM_12:1,913,041..1,915,149(+) | PcyM_12:1913041..1915149(+) | PcyM_12 | Plasmodium cynomolgi strain M | 44 | OG6_101196 | 0 | 702 | 2109 | 78957 | 9.37 | 0 | | | GO:0016020 | membrane | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1247900ORATP-dependent zinc metalloprotease FTSH, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1247900 OR ATP-dependent zinc metalloprotease FTSH, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1252900 | PcyM_1252900-t36_1 | 9 | 9 | 1 | | | reverse | protein coding | No | 687 | PcyM_1252900 | ubiquitin carboxyl-terminal hydrolase isozyme L3, putative | ubiquitin carboxyl-terminal hydrolase isozyme L3, putative | | | 12 | PcyM_12:2,112,853..2,114,724(-) | PcyM_12:2112853..2114724(-) | PcyM_12 | Plasmodium cynomolgi strain M | 44 | OG6_101218 | 0 | 228 | 687 | 25787 | 4.77 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1252900ORubiquitin carboxyl-terminal hydrolase isozyme L3, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1252900 OR ubiquitin carboxyl-terminal hydrolase isozyme L3, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1255400 | PcyM_1255400-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1731 | PcyM_1255400 | vivapain-1 | vivapain-1 | | | 12 | PcyM_12:2,194,149..2,195,879(-) | PcyM_12:2194149..2195879(-) | PcyM_12 | Plasmodium cynomolgi strain M | 157 | OG6_100116 | 3 | 576 | 1731 | 65845 | 7.94 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1255400ORvivapain-1ANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1255400 OR vivapain-1 AND Plasmodium cynomolgi strain M |
|
PcyM_1256400 | PcyM_1256400-t36_1 | 9 | 9 | 1 | | | forward | protein coding | No | 1242 | PcyM_1256400 | signal peptide peptidase, putative | signal peptide peptidase, putative | | | 12 | PcyM_12:2,247,867..2,250,649(+) | PcyM_12:2247867..2250649(+) | PcyM_12 | Plasmodium cynomolgi strain M | 44 | OG6_102328 | 0 | 413 | 1242 | 47348 | 9.10 | 8 | | | GO:0016021 | integral component of membrane | GO:0004190 | aspartic-type endopeptidase activity | | | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1256400ORsignal peptide peptidase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1256400 OR signal peptide peptidase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1260600 | PcyM_1260600-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2466 | PcyM_1260600 | aminopeptidase P, putative | aminopeptidase P, putative | | | 12 | PcyM_12:2,451,624..2,454,089(-) | PcyM_12:2451624..2454089(-) | PcyM_12 | Plasmodium cynomolgi strain M | 44 | OG6_100896 | 0 | 821 | 2466 | 93506 | 6.69 | 0 | | | | | GO:0016787 | hydrolase activity | | | | | | | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1260600ORaminopeptidase P, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1260600 OR aminopeptidase P, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1262900 | PcyM_1262900-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1068 | PcyM_1262900 | DER1-like protein, putative | DER1-like protein, putative | | | 12 | PcyM_12:2,544,859..2,545,926(+) | PcyM_12:2544859..2545926(+) | PcyM_12 | Plasmodium cynomolgi strain M | 44 | OG6_160757 | 0 | 355 | 1068 | 41813 | 10.20 | 5 | HMM: MNIVLCLIWILIYIADDGSKAN, NN: MNIVLCLIWILIYIADDGSKAN | NN Sum: 4, NN D: .62, HMM Prob: .92 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1262900ORDER1-like protein, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1262900 OR DER1-like protein, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1269600 | PcyM_1269600-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1842 | PcyM_1269600 | M17 leucyl aminopeptidase, putative | M17 leucyl aminopeptidase, putative | | | 12 | PcyM_12:2,820,753..2,822,594(+) | PcyM_12:2820753..2822594(+) | PcyM_12 | Plasmodium cynomolgi strain M | 47 | OG6_100682 | 0 | 613 | 1842 | 67821 | 7.73 | 0 | | | GO:0005622 | intracellular | GO:0004177 | aminopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.11.1 (Leucyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1269600ORM17 leucyl aminopeptidase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1269600 OR M17 leucyl aminopeptidase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1274200 | PcyM_1274200-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1503 | PcyM_1274200 | metalloprotease, putative | metalloprotease, putative | | | 12 | PcyM_12:3,027,543..3,029,045(-) | PcyM_12:3027543..3029045(-) | PcyM_12 | Plasmodium cynomolgi strain M | 44 | OG6_102968 | 0 | 500 | 1503 | 57981 | 9.26 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | | | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1274200ORmetalloprotease, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1274200 OR metalloprotease, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1275600 | PcyM_1275600-t36_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 4602 | PcyM_1275600 | stromal-processing peptidase, putative | stromal-processing peptidase, putative | | | 12 | PcyM_12:3,092,704..3,100,869(-) | PcyM_12:3092704..3100869(-) | PcyM_12 | Plasmodium cynomolgi strain M | 43 | OG6_110270 | 0 | 1533 | 4602 | 177716 | 6.64 | 0 | HMM: MIKINGIILLYFSVLNLVCCL, NN: MIKINGIILLYFSVLNLVCCL | NN Sum: 4, NN D: .78, HMM Prob: .86 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1275600ORstromal-processing peptidase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1275600 OR stromal-processing peptidase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1277700 | PcyM_1277700-t36_1 | 7 | 7 | 1 | | | reverse | protein coding | No | 5688 | PcyM_1277700 | metacaspase 2, putative | metacaspase 2, putative | | | 12 | PcyM_12:3,193,784..3,201,630(-) | PcyM_12:3193784..3201630(-) | PcyM_12 | Plasmodium cynomolgi strain M | 83 | OG6_101407 | 1 | 1895 | 5688 | 214938 | 9.86 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1277700ORmetacaspase 2, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1277700 OR metacaspase 2, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1279200 | PcyM_1279200-t36_1 | 3 | 3 | 1 | | | forward | protein coding | No | 810 | PcyM_1279200 | proteasome subunit alpha type-1, putative | proteasome subunit alpha type-1, putative | | | 12 | PcyM_12:3,255,138..3,256,405(+) | PcyM_12:3255138..3256405(+) | PcyM_12 | Plasmodium cynomolgi strain M | 44 | OG6_102143 | 0 | 269 | 810 | 30737 | 5.47 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1279200ORproteasome subunit alpha type-1, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1279200 OR proteasome subunit alpha type-1, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1281000 | PcyM_1281000-t36_1 | 2 | 2 | 1 | | | forward | protein coding | No | 1653 | PcyM_1281000 | lysophospholipase, putative | lysophospholipase, putative | | | 12 | PcyM_12:3,351,779..3,353,432(+) | PcyM_12:3351779..3353432(+) | PcyM_12 | Plasmodium cynomolgi strain M | 454 | OG6_100231 | 7 | 550 | 1653 | 62746 | 9.75 | 1 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1281000ORlysophospholipase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1281000 OR lysophospholipase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1301900 | PcyM_1301900-t36_1 | 7 | 7 | 1 | | | forward | protein coding | No | 1116 | PcyM_1301900 | SRAP domain-containing protein, putative | SRAP domain-containing protein, putative | | | 13 | PcyM_13:82,962..85,200(+) | PcyM_13:82962..85200(+) | PcyM_13 | Plasmodium cynomolgi strain M | 42 | OG6_102318 | 0 | 371 | 1116 | 43235 | 8.40 | 0 | | | | | | | | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1301900ORSRAP domain-containing protein, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1301900 OR SRAP domain-containing protein, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1306200 | PcyM_1306200-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3507 | PcyM_1306200 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | | | 13 | PcyM_13:254,053..257,559(-) | PcyM_13:254053..257559(-) | PcyM_13 | Plasmodium cynomolgi strain M | 43 | OG6_102131 | 0 | 1168 | 3507 | 130364 | 6.22 | 2 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1306200ORconserved Plasmodium protein, unknown functionANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1306200 OR conserved Plasmodium protein, unknown function AND Plasmodium cynomolgi strain M |
|
PcyM_1314700 | PcyM_1314700-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 750 | PcyM_1314700 | ATP-dependent Clp protease proteolytic subunit, putative | ATP-dependent Clp protease proteolytic subunit, putative | | | 13 | PcyM_13:620,407..621,156(+) | PcyM_13:620407..621156(+) | PcyM_13 | Plasmodium cynomolgi strain M | 42 | OG6_113660 | 0 | 249 | 750 | 28075 | 9.48 | 0 | NN: MQSYLLLLVAIALSPLCAH, HMM: MQSYLLLLVAIALSPLCAH | NN Sum: 4, NN D: .74, HMM Prob: 1 | | | | | | | | | | | | | | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1314700ORATP-dependent Clp protease proteolytic subunit, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1314700 OR ATP-dependent Clp protease proteolytic subunit, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1314800 | PcyM_1314800-t36_1 | 2 | 2 | 1 | | | forward | protein coding | No | 2625 | PcyM_1314800 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | | | 13 | PcyM_13:621,228..624,077(+) | PcyM_13:621228..624077(+) | PcyM_13 | Plasmodium cynomolgi strain M | 45 | OG6_146174 | 0 | 874 | 2625 | 100973 | 8.03 | 0 | | | | | | | | | | | | | | | | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1314800ORconserved Plasmodium protein, unknown functionANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1314800 OR conserved Plasmodium protein, unknown function AND Plasmodium cynomolgi strain M |
|
PcyM_1317000 | PcyM_1317000-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1719 | PcyM_1317000 | methionine aminopeptidase 2, putative | methionine aminopeptidase 2, putative | | | 13 | PcyM_13:716,865..718,583(-) | PcyM_13:716865..718583(-) | PcyM_13 | Plasmodium cynomolgi strain M | 45 | OG6_100815 | 0 | 572 | 1719 | 63949 | 8.34 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1317000ORmethionine aminopeptidase 2, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1317000 OR methionine aminopeptidase 2, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1318000 | PcyM_1318000-t36_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 306 | PcyM_1318000 | microsomal signal peptidase 12 kDa subunit, putative | microsomal signal peptidase 12 kDa subunit, putative | | | 13 | PcyM_13:781,988..782,656(-) | PcyM_13:781988..782656(-) | PcyM_13 | Plasmodium cynomolgi strain M | 44 | OG6_103297 | 0 | 101 | 306 | 11535 | 9.95 | 2 | | | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1318000ORmicrosomal signal peptidase 12 kDa subunit, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1318000 OR microsomal signal peptidase 12 kDa subunit, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1319100 | PcyM_1319100-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 3864 | PcyM_1319100 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | | | 13 | PcyM_13:841,487..845,350(+) | PcyM_13:841487..845350(+) | PcyM_13 | Plasmodium cynomolgi strain M | 42 | OG6_532401 | 0 | 1287 | 3864 | 145999 | 9.19 | 0 | | | | | GO:0003677 | DNA binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1319100ORconserved Plasmodium protein, unknown functionANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1319100 OR conserved Plasmodium protein, unknown function AND Plasmodium cynomolgi strain M |
|
PcyM_1322200 | PcyM_1322200-t36_1 | 8 | 8 | 1 | | | reverse | protein coding | No | 2187 | PcyM_1322200 | aspartyl protease, putative | aspartyl protease, putative | | | 13 | PcyM_13:936,310..939,785(-) | PcyM_13:936310..939785(-) | PcyM_13 | Plasmodium cynomolgi strain M | 91 | OG6_119797 | 1 | 728 | 2187 | 84357 | 9.31 | 1 | NN: MPPRRFQKLGSKLLSTLLIHPTASLLFVVHLFLFRQGSCV, HMM: MPPRRFQKLGSKLLSTLLIHPTASLLFVVHLFLFRQGSCV | NN Sum: 4, NN D: .64, HMM Prob: .8 | | | | | | | | | | | | | | 3.4.23.1 (Pepsin A) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1322200ORaspartyl protease, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1322200 OR aspartyl protease, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1324300 | PcyM_1324300-t36_1 | 2 | 2 | 1 | | | forward | protein coding | No | 1137 | PcyM_1324300 | proliferation-associated protein 2g4, putative | proliferation-associated protein 2g4, putative | | | 13 | PcyM_13:1,025,572..1,026,888(+) | PcyM_13:1025572..1026888(+) | PcyM_13 | Plasmodium cynomolgi strain M | 42 | OG6_101895 | 0 | 378 | 1137 | 42609 | 7.45 | 0 | | | | | | | | | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1324300ORproliferation-associated protein 2g4, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1324300 OR proliferation-associated protein 2g4, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1325800 | PcyM_1325800-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 5559 | PcyM_1325800 | lipase, putative | lipase, putative | | | 13 | PcyM_13:1,074,971..1,080,529(-) | PcyM_13:1074971..1080529(-) | PcyM_13 | Plasmodium cynomolgi strain M | 43 | OG6_145929 | 0 | 1852 | 5559 | 212758 | 4.86 | 0 | HMM: MIPCVLLYCFNLLFLAYFLKVSCS, NN: MIPCVLLYCFNLLFLAYFLKVSCSSCD | NN Sum: 4, NN D: .67, HMM Prob: .99 | | | | | GO:0006629 | lipid metabolic process | | | | | | | | 3.1.1.3 (Triacylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1325800ORlipase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1325800 OR lipase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1328100 | PcyM_1328100-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1311 | PcyM_1328100 | enoyl-CoA hydratase, putative | enoyl-CoA hydratase, putative | | | 13 | PcyM_13:1,155,493..1,156,803(+) | PcyM_13:1155493..1156803(+) | PcyM_13 | Plasmodium cynomolgi strain M | 44 | OG6_102410 | 0 | 436 | 1311 | 48893 | 9.10 | 0 | | | | | GO:0003824 | catalytic activity | GO:0008152 | metabolic process | | | | | | | | 4.2.1.17 (Enoyl-CoA hydratase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1328100ORenoyl-CoA hydratase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1328100 OR enoyl-CoA hydratase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1337000 | PcyM_1337000-t36_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 3117 | PcyM_1337000 | cysteine protease ATG4, putative | cysteine protease ATG4, putative | | | 13 | PcyM_13:1,440,853..1,444,250(-) | PcyM_13:1440853..1444250(-) | PcyM_13 | Plasmodium cynomolgi strain M | 41 | OG6_100501 | 0 | 1038 | 3117 | 118656 | 9.63 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1337000ORcysteine protease ATG4, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1337000 OR cysteine protease ATG4, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1338400 | PcyM_1338400-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 6048 | PcyM_1338400 | metacaspase-like protein | metacaspase-like protein | | | 13 | PcyM_13:1,501,405..1,507,452(+) | PcyM_13:1501405..1507452(+) | PcyM_13 | Plasmodium cynomolgi strain M | 46 | OG6_119794 | 0 | 2015 | 6048 | 225499 | 9.82 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1338400ORmetacaspase-like proteinANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1338400 OR metacaspase-like protein AND Plasmodium cynomolgi strain M |
|
PcyM_1339900 | PcyM_1339900-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 3078 | PcyM_1339900 | ATP-dependent protease, putative | ATP-dependent protease, putative | | | 13 | PcyM_13:1,560,751..1,563,828(+) | PcyM_13:1560751..1563828(+) | PcyM_13 | Plasmodium cynomolgi strain M | 47 | OG6_100411 | 0 | 1025 | 3078 | 116640 | 8.10 | 0 | | | | | GO:0005524;GO:0004176;GO:0004252 | ATP binding;ATP-dependent peptidase activity;serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1339900ORATP-dependent protease, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1339900 OR ATP-dependent protease, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1340100 | PcyM_1340100-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 3849 | PcyM_1340100 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | | 13 | PcyM_13:1,568,988..1,572,836(+) | PcyM_13:1568988..1572836(+) | PcyM_13 | Plasmodium cynomolgi strain M | 47 | OG6_101457 | 1 | 1282 | 3849 | 144739 | 9.99 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1340100ORubiquitin carboxyl-terminal hydrolase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1340100 OR ubiquitin carboxyl-terminal hydrolase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1340400 | PcyM_1340400-t36_1 | 5 | 5 | 1 | | | forward | protein coding | No | 7098 | PcyM_1340400 | atypical protein kinase, ABC-1 family, putative | atypical protein kinase, ABC-1 family, putative | | | 13 | PcyM_13:1,579,541..1,587,405(+) | PcyM_13:1579541..1587405(+) | PcyM_13 | Plasmodium cynomolgi strain M | 48 | OG6_112296 | 0 | 2365 | 7098 | 267166 | 9.74 | 0 | | | | | | | | | | | | | | | | 1.14.13.- (With NADH or NADPH as one donor, and incorporation of one atom of oxygen.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1340400ORatypical protein kinase, ABC-1 family, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1340400 OR atypical protein kinase, ABC-1 family, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1344200 | PcyM_1344200-t36_1 | 4 | 4 | 1 | | | forward | protein coding | No | 2478 | PcyM_1344200 | rhomboid protease ROM8, putative | rhomboid protease ROM8, putative | | | 13 | PcyM_13:1,727,540..1,730,480(+) | PcyM_13:1727540..1730480(+) | PcyM_13 | Plasmodium cynomolgi strain M | 44 | OG6_533440 | 0 | 825 | 2478 | 96053 | 6.88 | 6 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1344200ORrhomboid protease ROM8, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1344200 OR rhomboid protease ROM8, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1345900 | PcyM_1345900-t36_1 | 7 | 7 | 1 | | | reverse | protein coding | No | 945 | PcyM_1345900 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | | | 13 | PcyM_13:1,789,587..1,791,633(-) | PcyM_13:1789587..1791633(-) | PcyM_13 | Plasmodium cynomolgi strain M | 43 | OG6_112275 | 0 | 314 | 945 | 36307 | 9.54 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1345900ORalpha/beta hydrolase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1345900 OR alpha/beta hydrolase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1347000 | PcyM_1347000-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1182 | PcyM_1347000 | DNA damage-inducible protein 1, putative | DNA damage-inducible protein 1, putative | | | 13 | PcyM_13:1,835,426..1,836,607(-) | PcyM_13:1835426..1836607(-) | PcyM_13 | Plasmodium cynomolgi strain M | 45 | OG6_101685 | 0 | 393 | 1182 | 44101 | 4.80 | 0 | | | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1347000ORDNA damage-inducible protein 1, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1347000 OR DNA damage-inducible protein 1, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1348200 | PcyM_1348200-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1353 | PcyM_1348200 | plasmepsin IV, putative | plasmepsin IV, putative | | | 13 | PcyM_13:1,903,567..1,904,919(-) | PcyM_13:1903567..1904919(-) | PcyM_13 | Plasmodium cynomolgi strain M | 158 | OG6_100536 | 1 | 450 | 1353 | 51624 | 4.92 | 1 | | | | | | | | | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1348200ORplasmepsin IV, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1348200 OR plasmepsin IV, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1349400 | PcyM_1349400-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3837 | PcyM_1349400 | ATP-dependent Clp protease, putative | ATP-dependent Clp protease, putative | | | 13 | PcyM_13:1,950,778..1,954,614(-) | PcyM_13:1950778..1954614(-) | PcyM_13 | Plasmodium cynomolgi strain M | 42 | OG6_532618 | 0 | 1278 | 3837 | 145769 | 7.06 | 0 | NN: MNALYLLLAMLTLKLVVTI, HMM: MNALYLLLAMLTLKLVVTI | NN Sum: 4, NN D: .77, HMM Prob: 1 | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | | | | | | | | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1349400ORATP-dependent Clp protease, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1349400 OR ATP-dependent Clp protease, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1349500 | PcyM_1349500-t36_1 | 2 | 2 | 1 | | | forward | protein coding | No | 4782 | PcyM_1349500 | WD repeat-containing protein 65, putative | WD repeat-containing protein 65, putative | | | 13 | PcyM_13:1,956,539..1,961,585(+) | PcyM_13:1956539..1961585(+) | PcyM_13 | Plasmodium cynomolgi strain M | 50 | OG6_102663 | 0 | 1593 | 4782 | 182067 | 7.41 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1349500ORWD repeat-containing protein 65, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1349500 OR WD repeat-containing protein 65, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1402400 | PcyM_1402400-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1551 | PcyM_1402400 | lysophospholipase, putative | lysophospholipase, putative | | | 14 | PcyM_14:131,534..133,084(-) | PcyM_14:131534..133084(-) | PcyM_14 | Plasmodium cynomolgi strain M | 454 | OG6_100231 | 7 | 516 | 1551 | 59108 | 4.29 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1402400ORlysophospholipase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1402400 OR lysophospholipase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1407100 | PcyM_1407100-t36_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 993 | PcyM_1407100 | membrane integral peptidase, M50 family, putative | membrane integral peptidase, M50 family, putative | | | 14 | PcyM_14:357,819..358,990(-) | PcyM_14:357819..358990(-) | PcyM_14 | Plasmodium cynomolgi strain M | 43 | OG6_107106 | 0 | 330 | 993 | 38697 | 7.48 | 8 | | | | | | | | | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1407100ORmembrane integral peptidase, M50 family, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1407100 OR membrane integral peptidase, M50 family, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1407900 | PcyM_1407900-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1182 | PcyM_1407900 | 26S protease regulatory subunit 10B, putative | 26S protease regulatory subunit 10B, putative | | | 14 | PcyM_14:384,895..386,076(-) | PcyM_14:384895..386076(-) | PcyM_14 | Plasmodium cynomolgi strain M | 44 | OG6_101751 | 0 | 393 | 1182 | 44688 | 8.93 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1407900OR26S protease regulatory subunit 10B, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1407900 OR 26S protease regulatory subunit 10B, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1413200 | PcyM_1413200-t36_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1263 | PcyM_1413200 | 26S protease regulatory subunit 7, putative | 26S protease regulatory subunit 7, putative | | | 14 | PcyM_14:594,802..596,314(-) | PcyM_14:594802..596314(-) | PcyM_14 | Plasmodium cynomolgi strain M | 44 | OG6_101899 | 0 | 420 | 1263 | 46708 | 6.66 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1413200OR26S protease regulatory subunit 7, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1413200 OR 26S protease regulatory subunit 7, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1413500 | PcyM_1413500-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 3294 | PcyM_1413500 | M1-family alanyl aminopeptidase, putative | M1-family alanyl aminopeptidase, putative | | | 14 | PcyM_14:607,362..610,655(+) | PcyM_14:607362..610655(+) | PcyM_14 | Plasmodium cynomolgi strain M | 44 | OG6_106799 | 0 | 1097 | 3294 | 126343 | 7.27 | 1 | HMM: MIRKKMLNLYFLFVTVLVALAN, NN: MIRKKMLNLYFLFVTVLVALAN | NN Sum: 4, NN D: .89, HMM Prob: .92 | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | | 3.4.11.2 (Membrane alanyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1413500ORM1-family alanyl aminopeptidase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1413500 OR M1-family alanyl aminopeptidase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1418700 | PcyM_1418700-t36_1 | 3 | 3 | 1 | | | forward | protein coding | No | 2142 | PcyM_1418700 | U4/U6.U5 tri-snRNP-associated protein 2, putative | U4/U6.U5 tri-snRNP-associated protein 2, putative | | | 14 | PcyM_14:832,805..834,948(+) | PcyM_14:832805..834948(+) | PcyM_14 | Plasmodium cynomolgi strain M | 45 | OG6_102786 | 0 | 713 | 2142 | 80803 | 6.79 | 0 | | | | | GO:0036459;GO:0008270 | thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579 | protein deubiquitination | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1418700ORU4/U6.U5 tri-snRNP-associated protein 2, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1418700 OR U4/U6.U5 tri-snRNP-associated protein 2, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1420900 | PcyM_1420900-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 2061 | PcyM_1420900 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | | | 14 | PcyM_14:922,226..924,286(+) | PcyM_14:922226..924286(+) | PcyM_14 | Plasmodium cynomolgi strain M | 44 | OG6_102202 | 0 | 686 | 2061 | 78414 | 7.57 | 0 | | | | | GO:1990380;GO:0004843 | Lys48-specific deubiquitinase activity;thiol-dependent ubiquitin-specific protease activity | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1420900ORconserved Plasmodium protein, unknown functionANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1420900 OR conserved Plasmodium protein, unknown function AND Plasmodium cynomolgi strain M |
|
PcyM_1422200 | PcyM_1422200-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 951 | PcyM_1422200 | type I signal peptidase, putative | type I signal peptidase, putative | | | 14 | PcyM_14:977,610..978,560(-) | PcyM_14:977610..978560(-) | PcyM_14 | Plasmodium cynomolgi strain M | 44 | OG6_100609 | 0 | 316 | 951 | 37124 | 10.63 | 1 | | | | | | | | | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1422200ORtype I signal peptidase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1422200 OR type I signal peptidase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1429300 | PcyM_1429300-t36_1 | 12 | 12 | 1 | | | forward | protein coding | No | 1587 | PcyM_1429300 | trypsin-like serine protease, putative | trypsin-like serine protease, putative | | | 14 | PcyM_14:1,253,362..1,257,047(+) | PcyM_14:1253362..1257047(+) | PcyM_14 | Plasmodium cynomolgi strain M | 39 | OG6_100391 | 0 | 528 | 1587 | 60580 | 6.41 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.4.21.107 (Peptidase Do) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1429300ORtrypsin-like serine protease, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1429300 OR trypsin-like serine protease, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1429400 | PcyM_1429400-t36_1 | 5 | 5 | 1 | | | forward | protein coding | No | 870 | PcyM_1429400 | GTPase, putative | GTPase, putative | | | 14 | PcyM_14:1,257,140..1,258,967(+) | PcyM_14:1257140..1258967(+) | PcyM_14 | Plasmodium cynomolgi strain M | 131 | OG6_101142 | 2 | 289 | 870 | 33949 | 10.22 | 0 | HMM: MRSVVKSPFSLFFWVFCVNVTRLCCF, NN: MRSVVKSPFSLFFWVFCVNVTRLCCF | NN Sum: 4, NN D: .61, HMM Prob: .98 | | | GO:0005525 | GTP binding | | | | | | | | | | 3.6.5.1 (Heterotrimeric G-protein GTPase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1429400ORGTPase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1429400 OR GTPase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1432100 | PcyM_1432100-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 15753 | PcyM_1432100 | separase, putative | separase, putative | | | 14 | PcyM_14:1,386,935..1,402,687(+) | PcyM_14:1386935..1402687(+) | PcyM_14 | Plasmodium cynomolgi strain M | 36 | OG6_150828 | 0 | 5250 | 15753 | 613763 | 8.76 | 7 | | | | | GO:0008233 | peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.49 (Separase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1432100ORseparase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1432100 OR separase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1438200 | PcyM_1438200-t36_1 | 3 | 3 | 1 | | | forward | protein coding | No | 1254 | PcyM_1438200 | PPPDE peptidase domain-containing protein, putative | PPPDE peptidase domain-containing protein, putative | | | 14 | PcyM_14:1,598,670..1,600,429(+) | PcyM_14:1598670..1600429(+) | PcyM_14 | Plasmodium cynomolgi strain M | 44 | OG6_102579 | 0 | 417 | 1254 | 48325 | 4.95 | 0 | | | | | | | | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1438200ORPPPDE peptidase domain-containing protein, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1438200 OR PPPDE peptidase domain-containing protein, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1447800 | PcyM_1447800-t36_1 | 6 | 6 | 1 | | | forward | protein coding | No | 1224 | PcyM_1447800 | ataxin-3, putative | ataxin-3, putative | | | 14 | PcyM_14:2,016,576..2,018,679(+) | PcyM_14:2016576..2018679(+) | PcyM_14 | Plasmodium cynomolgi strain M | 44 | OG6_104644 | 0 | 407 | 1224 | 46258 | 6.51 | 0 | | | | | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1447800ORataxin-3, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1447800 OR ataxin-3, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1452800 | PcyM_1452800-t36_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 624 | PcyM_1452800 | ATP-dependent protease subunit ClpQ, putative | ATP-dependent protease subunit ClpQ, putative | | | 14 | PcyM_14:2,189,469..2,190,843(-) | PcyM_14:2189469..2190843(-) | PcyM_14 | Plasmodium cynomolgi strain M | 44 | OG6_107204 | 0 | 207 | 624 | 22653 | 8.48 | 0 | | | GO:0009376;GO:0005839 | HslUV protease complex;proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0006508;GO:0051603 | proteolysis;proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.2 (HslU--HslV peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1452800ORATP-dependent protease subunit ClpQ, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1452800 OR ATP-dependent protease subunit ClpQ, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1457100 | PcyM_1457100-t36_1 | 3 | 3 | 1 | | | forward | protein coding | No | 3453 | PcyM_1457100 | sentrin-specific protease 1, putative | sentrin-specific protease 1, putative | | | 14 | PcyM_14:2,356,846..2,360,896(+) | PcyM_14:2356846..2360896(+) | PcyM_14 | Plasmodium cynomolgi strain M | 44 | OG6_101235 | 0 | 1150 | 3453 | 129820 | 8.77 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.68 (Ulp1 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1457100ORsentrin-specific protease 1, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1457100 OR sentrin-specific protease 1, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1457700 | PcyM_1457700-t36_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 1851 | PcyM_1457700 | aspartyl protease, putative | aspartyl protease, putative | | | 14 | PcyM_14:2,387,079..2,390,104(-) | PcyM_14:2387079..2390104(-) | PcyM_14 | Plasmodium cynomolgi strain M | 44 | OG6_127652 | 0 | 616 | 1851 | 67667 | 7.03 | 1 | HMM: MITRLVKMGRIVPLLFALAALLLYTHNETVCSGY, NN: MITRLVKMGRIVPLLFALAALLLYTHNE | NN Sum: 3, NN D: .68, HMM Prob: .98 | | | | | | | | | | | | | | 3.4.23.3 (Gastricsin) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1457700ORaspartyl protease, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1457700 OR aspartyl protease, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1463900 | PcyM_1463900-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 2637 | PcyM_1463900 | ATP-dependent zinc metalloprotease FTSH 1, putative | ATP-dependent zinc metalloprotease FTSH 1, putative | | | 14 | PcyM_14:2,610,198..2,612,834(+) | PcyM_14:2610198..2612834(+) | PcyM_14 | Plasmodium cynomolgi strain M | 91 | OG6_100384 | 1 | 878 | 2637 | 98637 | 10.06 | 1 | | | GO:0016020 | membrane | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1463900ORATP-dependent zinc metalloprotease FTSH 1, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1463900 OR ATP-dependent zinc metalloprotease FTSH 1, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1464200 | PcyM_1464200-t36_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1647 | PcyM_1464200 | 3-hydroxyisobutyryl-coenzyme A hydrolase, putative | 3-hydroxyisobutyryl-coenzyme A hydrolase, putative | | | 14 | PcyM_14:2,637,535..2,639,181(+) | PcyM_14:2637535..2639181(+) | PcyM_14 | Plasmodium cynomolgi strain M | 49 | OG6_102025 | 0 | 548 | 1647 | 62162 | 8.36 | 0 | | | | | GO:0003860 | 3-hydroxyisobutyryl-CoA hydrolase activity | | | | | | | | | | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1464200OR3-hydroxyisobutyryl-coenzyme A hydrolase, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1464200 OR 3-hydroxyisobutyryl-coenzyme A hydrolase, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1471400 | PcyM_1471400-t36_1 | 8 | 8 | 1 | | | forward | protein coding | No | 1866 | PcyM_1471400 | dipeptidyl aminopeptidase 2, putative | dipeptidyl aminopeptidase 2, putative | | | 14 | PcyM_14:2,889,255..2,892,816(+) | PcyM_14:2889255..2892816(+) | PcyM_14 | Plasmodium cynomolgi strain M | 90 | OG6_103622 | 1 | 621 | 1866 | 70071 | 6.57 | 0 | NN: MKYQLALSFLVLLVRYVEGD, HMM: MKYQLALSFLVLLVRYVEGD | NN Sum: 4, NN D: .91, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.14.1 (Dipeptidyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1471400ORdipeptidyl aminopeptidase 2, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1471400 OR dipeptidyl aminopeptidase 2, putative AND Plasmodium cynomolgi strain M |
|
PcyM_1472800 | PcyM_1472800-t36_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1275 | PcyM_1472800 | 26S protease regulatory subunit 8, putative | 26S protease regulatory subunit 8, putative | | | 14 | PcyM_14:2,931,090..2,932,364(-) | PcyM_14:2931090..2932364(-) | PcyM_14 | Plasmodium cynomolgi strain M | 44 | OG6_101513 | 0 | 424 | 1275 | 48268 | 6.86 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.3 (Transferred entry: 5.6.1.1) | https://pubmed.ncbi.nlm.nih.gov/?term=PcyM_1472800OR26S protease regulatory subunit 8, putativeANDPlasmodium cynomolgi strain M | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PcyM_1472800 OR 26S protease regulatory subunit 8, putative AND Plasmodium cynomolgi strain M |